Align Carbamate kinase; EC 2.7.2.2 (characterized, see rationale)
to candidate SMa0697 SMa0697 carbamate kinase
Query= uniprot:P13982 (310 letters) >FitnessBrowser__Smeli:SMa0697 Length = 324 Score = 398 bits (1023), Expect = e-116 Identities = 196/311 (63%), Positives = 244/311 (78%), Gaps = 3/311 (0%) Query: 1 MRIVVALGGNALLRRGEPMTADNQRENVRIAAEQIAKVAPGNELVIAHGNGPQVGLLALQ 60 MR+V+ALGGNALL+RGEPMTA+ QR+N++IAAE IA +A +++V+ HGNGPQVGLLALQ Sbjct: 1 MRVVIALGGNALLKRGEPMTAEVQRQNIKIAAEAIAPIAAEHQIVVTHGNGPQVGLLALQ 60 Query: 61 GAAYDKVSPYPLDVLGAETEGMIGYMIEQEMGNLLPFEVPFATILTQVEVDGKDPAFQNP 120 G+AY YPLD+LGAETEGMIGYM+EQE+GN+LPFEVP ATILT VEVDG DP FQNP Sbjct: 61 GSAYKPEEAYPLDILGAETEGMIGYMLEQELGNVLPFEVPLATILTMVEVDGNDPGFQNP 120 Query: 121 TKPIGPVYSREEAERLAAEKGWSIAPDGDKFRRVVPSPRPKRIFEIRPVKWLLEKGTIVI 180 TK +GPVY EA L +KGW DG+K+RRVV SP P+RIFE+RP++WLL+KG +VI Sbjct: 121 TKFVGPVYDASEAGELHQQKGWVFKQDGNKWRRVVASPIPRRIFELRPIQWLLDKGAVVI 180 Query: 181 CAGGGGIPTMYDEAGKK--LSGVEAVIDKDLCSSLLAQELVADILIIATDVDAAYVDWGK 238 CAGGGGIPTMY E GK+ L GVEAVIDKDLCS+LLA+++ AD+LI+ATD +A + WG Sbjct: 181 CAGGGGIPTMY-ERGKERTLIGVEAVIDKDLCSALLARDIEADLLILATDAEAVFTGWGT 239 Query: 239 PTQKAIAQAHPDELERLGFAAGSMGPKVQAAIEFARATGKDAVIGSLADIVAITEGKAGT 298 P +KAI + +P L F AGSMGPKV+AA F ATG+ A IG+LADI A+ + GT Sbjct: 240 PERKAIFKTNPRRLGEFSFPAGSMGPKVEAACHFVNATGRVAAIGALADIPAMVRAERGT 299 Query: 299 RVSTRKAGIEY 309 +S+ + I + Sbjct: 300 IISSSFSDITW 310 Lambda K H 0.317 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 324 Length adjustment: 27 Effective length of query: 283 Effective length of database: 297 Effective search space: 84051 Effective search space used: 84051 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate SMa0697 SMa0697 (carbamate kinase)
to HMM TIGR00746 (arcC: carbamate kinase (EC 2.7.2.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00746.hmm # target sequence database: /tmp/gapView.4666.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00746 [M=309] Accession: TIGR00746 Description: arcC: carbamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-117 375.5 0.0 9.8e-117 375.3 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMa0697 SMa0697 carbamate kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMa0697 SMa0697 carbamate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 375.3 0.0 9.8e-117 9.8e-117 1 308 [. 1 302 [. 1 303 [. 0.98 Alignments for each domain: == domain 1 score: 375.3 bits; conditional E-value: 9.8e-117 TIGR00746 1 kkvvvaLGGnallqrgekasaeeqrknvekaakqlvklakrgyelvithGngPqvGalllqneaadsvpakPldvl 76 ++vv+aLGGnall+rge ++ae qr+n+++aa++++ +a+ +++v+thGngPqvG l+lq +a++ +a+Pld+l lcl|FitnessBrowser__Smeli:SMa0697 1 MRVVIALGGNALLKRGEPMTAEVQRQNIKIAAEAIAPIAA-EHQIVVTHGNGPQVGLLALQGSAYKPEEAYPLDIL 75 589***********************************99.9********************************** PP TIGR00746 77 gaesqgliGYllqqalkeelakeglekkvatvltqvivdekDeaFqnPtkpigpfydeeeakrlaaekgailkeda 152 gae++g+iGY+l+q+l ++l+ +e ++at+lt v+vd +D+ FqnPtk++gp+yd ea +l ++kg+ +k+ + lcl|FitnessBrowser__Smeli:SMa0697 76 GAETEGMIGYMLEQELGNVLP---FEVPLATILTMVEVDGNDPGFQNPTKFVGPVYDASEAGELHQQKGWVFKQ-D 147 *********************...**************************************************.8 PP TIGR00746 153 grgwRrvvpsPkPkeiveaeviktLvekgvivissgGGGvPvvkdgke...lkGveaviDkDlasekLaeevnaDi 225 g++wRrvv+sP P++i+e + i++L++kg +vi++gGGG+P++++ + l GveaviDkDl+s++La++++aD lcl|FitnessBrowser__Smeli:SMa0697 148 GNKWRRVVASPIPRRIFELRPIQWLLDKGAVVICAGGGGIPTMYERGKertLIGVEAVIDKDLCSALLARDIEADL 223 99*****************************************99655466************************* PP TIGR00746 226 lviltdvdavyvnygkpdekkleevkveeleelakdgefaaGsmgPkveaaiefvesrgkkaiitslekivealeg 301 l+++td++av++ +g+p+ k++ + ++ l e+ f aGsmgPkveaa +fv+++g a i++l++i +++ lcl|FitnessBrowser__Smeli:SMa0697 224 LILATDAEAVFTGWGTPERKAIFKTNPRRLGEFS----FPAGSMGPKVEAACHFVNATGRVAAIGALADIPAMVRA 295 *********************************9....************************************** PP TIGR00746 302 kaGtvvv 308 + Gt+++ lcl|FitnessBrowser__Smeli:SMa0697 296 ERGTIIS 302 ****997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.40 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory