Align AotJ aka PA0888, component of Arginine/ornithine (but not lysine) porter (characterized)
to candidate SMa0495 SMa0495 ABC transporter substrate-binding protein
Query= TCDB::O50181 (259 letters) >FitnessBrowser__Smeli:SMa0495 Length = 272 Score = 169 bits (427), Expect = 7e-47 Identities = 97/259 (37%), Positives = 149/259 (57%), Gaps = 10/259 (3%) Query: 5 ALLGALALSVLSLPTFAADKPVRIGIEAAYPPFSLKTPDGQLAGFDVDIGNALCEEMKVQ 64 +L G + +LS AD +R+G+E Y PF+ +T DG+L G+DVD+ + E + V Sbjct: 10 SLTGLITAVLLSAAPANADT-LRVGMECTYAPFNYRTSDGKLEGYDVDVAKGISEIIGVD 68 Query: 65 CKWVEQEFDGLIPALKVRKIDAILSSMTITDERKRSVDFTNKYYNTPARFVMKEGASLN- 123 ++V QE+DG+IPAL K D I++SM+ITD+RK +DF++ Y N+ R V G L Sbjct: 69 FEYVCQEWDGMIPALLANKFDLIIASMSITDKRKEQIDFSSPYRNSVGRIVGPVGKDLKL 128 Query: 124 -DPK-----ADLKGKKAGVLRGSTADRYASAELTPAGVEVVRYNSQQEANMDLVAGRLDA 177 D K + G + GV R ST + SA+L A ++V Y+S + +DL GR+D Sbjct: 129 FDDKGQPVVGNFDGLRIGVERASTYFEWFSAKLPKA--DLVLYDSNEAMYLDLKNGRVDV 186 Query: 178 VVADSVNLEDGFLKTDAGKGYAFVGPQLTDAKYFGEGVGIAVRKGDSELAGKFNAAIDAL 237 ++ + + FL + Y F+GP++ + K+FG GVG+ +RKG+ EL K +AAI L Sbjct: 187 IMTNPMKAHLSFLSGEGKGKYEFIGPEVNEPKFFGPGVGVGLRKGNDELRDKISAAIRKL 246 Query: 238 RANGKYKQIQDKYFSFDVY 256 GK K+ K F F ++ Sbjct: 247 IREGKLKEYALKIFPFQIH 265 Lambda K H 0.316 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 272 Length adjustment: 25 Effective length of query: 234 Effective length of database: 247 Effective search space: 57798 Effective search space used: 57798 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory