Align ABC transporter for L-Arginine, putative ATPase component (characterized)
to candidate SMa2195 SMa2195 ABC transporter ATP-binding protein
Query= reanno::BFirm:BPHYT_RS07685 (263 letters) >FitnessBrowser__Smeli:SMa2195 Length = 254 Score = 254 bits (649), Expect = 1e-72 Identities = 136/244 (55%), Positives = 168/244 (68%), Gaps = 4/244 (1%) Query: 17 IHKRYGDNEVLKGVSLNANKGDVISIIGASGSGKSTFLRCINFLERPNAGQIVVDGEMVK 76 + K YG VL ++L G+VIS+IG SGSGKST LRC+N LER G I VDGE++ Sbjct: 11 VSKSYGSMTVLNDINLEIATGEVISLIGPSGSGKSTLLRCVNHLERIERGSITVDGELIG 70 Query: 77 TKTDRAGNL-EVADHKQLQRIRTKLAMVFQHFNLWAHMNVLENIVEAPIHVLGLKRKEAE 135 + R GNL K + R R + MVFQ+FNL+ H LEN++EAP+HV GL R++AE Sbjct: 71 YR--RVGNLAHELPEKLVARQRAGIGMVFQNFNLFGHKTALENVIEAPVHVRGLARRDAE 128 Query: 136 DRAREYLEKVGLAPRLEKQYPSHLSGGQQQRVAIARALAMNPDVMLFDEPTSALDPELVG 195 +A LE+VGLA +++ YP LSGGQQQRVAIARALAM P V+LFDEPTSALDPELVG Sbjct: 129 AQATALLERVGLADKMQS-YPRMLSGGQQQRVAIARALAMKPKVLLFDEPTSALDPELVG 187 Query: 196 EVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRTEEEGLPAEVLSAPRSERLK 255 EVL VM+ LA EG TM+VVTHEM FAR V N + F+ G E G P+E+ P +R + Sbjct: 188 EVLDVMRSLAAEGLTMMVVTHEMSFAREVCNRIAFMQAGEIVECGAPSEIFDKPAFQRTR 247 Query: 256 QFLS 259 FLS Sbjct: 248 SFLS 251 Lambda K H 0.318 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 254 Length adjustment: 24 Effective length of query: 239 Effective length of database: 230 Effective search space: 54970 Effective search space used: 54970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory