Align arginine-pyruvate transaminase (EC 2.6.1.84) (characterized)
to candidate SMc04386 SMc04386 aspartate aminotransferase B protein
Query= BRENDA::Q9HUI9 (393 letters) >FitnessBrowser__Smeli:SMc04386 Length = 410 Score = 221 bits (562), Expect = 4e-62 Identities = 132/380 (34%), Positives = 207/380 (54%), Gaps = 15/380 (3%) Query: 23 RALARVEQGEEILLLSVGDPDFDTPAPIVQAAIDSLLAGNTHYADVRGKRALRQRIAERH 82 RA A +G+ +++L G+PDFDTP + QAA D++ G T Y + G L++ I E+ Sbjct: 32 RAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGETKYTALDGTPELKKAIREKF 91 Query: 83 RRRSGQAVDAEQVVVLAGAQCALYAVVQCLLNPGDEVIVAEPMYVTYEAVFGACGARVVP 142 +R +G A + +++ V GA+ L+ + L+PGDEVI+ P + +Y + C + V Sbjct: 92 QRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVIIPTPYWTSYSDIVHICEGKPVL 151 Query: 143 VPVRSENGFRVQAEEVAALITPRTRAMALNSPHNPSGASLPRATWEALAELCMAH-DLWM 201 + + +GFR+ AE++ A ITPRTR + LNSP NPSGA+ A + L E+ + H +W+ Sbjct: 152 IACDASSGFRLTAEKLEAAITPRTRWVLLNSPSNPSGAAYSAADYRPLLEVLLRHPHVWL 211 Query: 202 ISDEVYSELLFDG-EHVSPASL-PGMADRTATLNSLSKSHAMTGWRVGWVVGPAALCAHL 259 + D++Y +++DG V+PA L PG+ +RT T+N +SK++AMTGWR+G+ GP L + Sbjct: 212 LVDDMYEHIVYDGFRFVTPAQLEPGLKNRTLTVNGVSKAYAMTGWRIGYAGGPRELIKAM 271 Query: 260 ENLALCMLYGSPEFIQDAACTALEAPLPELEAMREAYRRRRDLVIECLADSPGLRPLRPD 319 + Q A+ AL P L+ E+++RRRDLV+ L GL P+ Sbjct: 272 AVVQSQATSCPSSISQAASVAALNGPQDFLKERTESFQRRRDLVVNGLNAIDGLDCRVPE 331 Query: 320 GGMF-------VMVDIRPTGLSAQA---FADRLLDRHGVSVLAGEAFGPSAAGHIRLGLV 369 G + V+ + P+G + F LL+ V+V+ G AFG S R+ Sbjct: 332 GAFYTFSGCAGVLGKVTPSGKRIKTDTDFCAYLLEDAHVAVVPGSAFGLSP--FFRISYA 389 Query: 370 LGAEPLREACRRIALCAAEL 389 L+EA RIA L Sbjct: 390 TSEAELKEALERIAAACDRL 409 Lambda K H 0.322 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 410 Length adjustment: 31 Effective length of query: 362 Effective length of database: 379 Effective search space: 137198 Effective search space used: 137198 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory