Align Probable 2-ketoarginine decarboxylase AruI; 2-oxo-5-guanidinopentanoate decarboxylase; 5-guanidino-2-oxopentanoate decarboxylase; EC 4.1.1.75 (characterized)
to candidate SMc04455 SMc04455 thiamine pyrophosphate protein
Query= SwissProt::Q9HUI8 (559 letters) >FitnessBrowser__Smeli:SMc04455 Length = 548 Score = 172 bits (437), Expect = 2e-47 Identities = 166/520 (31%), Positives = 240/520 (46%), Gaps = 50/520 (9%) Query: 31 TAGQALVRLLANYGVDTVFGIPGVHTLELYRGLPGSGIRHVLTRHEQGAGFMADGYARVS 90 T GQ +V LA GV + +PG L + L + I V+ R E GA MAD + R++ Sbjct: 3 TGGQLVVEALAANGVKRISCVPGESYLAVLDALYDADIEVVVCRQEGGAAMMADAWGRLT 62 Query: 91 GKPGVCFVITGPGVTNVATAIGQAYADSVP-LLVISSVNHSASLGKGWGCLHETQDQRAM 149 G+PG+C V GPG TN + + A DSVP +L I V A + + E + +RA Sbjct: 63 GEPGICMVTRGPGATNASAGLHVARQDSVPMILFIGQVQREAREREAF---QEIEYRRAF 119 Query: 150 TAPITAFSALALSPEQLPELIARAYAVFDSERPRPVHISIPLDVLAAPVAHDWSAAVARR 209 T + + P ++PE + RA+AV S RP PV +++P D+L + + AA A + Sbjct: 120 T-EVAKWVGEIDDPARIPEFVTRAFAVATSGRPGPVVLTLPEDMLTQ--STEAPAARAYQ 176 Query: 210 PGRGVPCSEALRAAAERLAAARRPMLIAGGGALAAGEALA---ALSERLAAPLFTSVAGK 266 P P + AE L+ A+RP+ I GG +A E++A + +ER P+ S + Sbjct: 177 PVESHPGPSQIAKLAELLSTAKRPIAILGGTRWSA-ESVAGFQSFAERWQLPVGCSFRRQ 235 Query: 267 GLLPPDAPLNAG-ASLCVAPGWE-MIAEADLVLAVG---TEMADTDFWRERLPLSGE-LI 320 L P AG + + P I EADLVL VG +EM + + +P + L+ Sbjct: 236 MLFDHLHPNYAGDVGIGINPSLAGEIREADLVLLVGGRFSEMPSSGYTLIDVPYPRQTLV 295 Query: 321 RVDIDPRKFNDFYPSAVALRGDARQTLEALLVRLPQEARDSAPAAARVARLRAE-IRAAH 379 V DP + Y +A+ R + AL P +AR + A ++ + Sbjct: 296 HVHPDPGELGRVYRPDLAIAASPRDFVAALSNLTPSA---EPHWSARTGEMHAAYLKWST 352 Query: 380 APLQALHQAILDRIAAALPADAFVSTDMTQLAYTGNYAFASRAPRSWLH----------- 428 P + + I L A+ T T A GNYA +WLH Sbjct: 353 PPEKGPGDVQMGPIVNWLEANTGPETIFTNGA--GNYA-------TWLHRFHRFRRYGTQ 403 Query: 429 -PTGYGTLGYGLPAGIGAKLGAPQRPGLVLVGDGGFLYTAQELATASEELDSPLVVLLWN 487 G++GYGLPA + AK P R + GDG FL QE ATA + P++VL+ N Sbjct: 404 AAPASGSMGYGLPAAVAAKHLHPDREVVCFAGDGCFLMHGQEFATA-VRYELPIIVLVVN 462 Query: 488 NDALGQIRDDMLGLDIEPVGVLP----RNPDFALLGRAYG 523 N G IR + + E G + NPDFA L RAYG Sbjct: 463 NGIYGTIR---MHQEREYPGRVSATDLTNPDFAALARAYG 499 Lambda K H 0.321 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 766 Number of extensions: 47 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 559 Length of database: 548 Length adjustment: 36 Effective length of query: 523 Effective length of database: 512 Effective search space: 267776 Effective search space used: 267776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory