Align aryl-acylamidase (EC 3.5.1.13); amidase (EC 3.5.1.4) (characterized)
to candidate SMc00161 SMc00161 NAD synthetase
Query= BRENDA::A0A088BHP3 (267 letters) >FitnessBrowser__Smeli:SMc00161 Length = 560 Score = 70.9 bits (172), Expect = 6e-17 Identities = 68/220 (30%), Positives = 103/220 (46%), Gaps = 16/220 (7%) Query: 1 MKISGLQTAGTPGDVAANLRELDAACRRARAEGAELLITTELFITGYDIGDAVRDLARTD 60 ++I+ Q T GD+A N+ + A A EGA+LL+ TELFI+GY D V A Sbjct: 11 LRIAVAQLNPTVGDIAGNVAKAREARTAAAREGADLLLLTELFISGYPPEDLVLKPAFLK 70 Query: 61 LLSPAQEIAAAH----GIALVLGAPEHDDGACYNSAFFIDPAGAILGRHRKNHL--FGDL 114 A E AA G +V+G P G +NS +D G ++ K L +G+ Sbjct: 71 ACEQAVEKLAAETADGGPGVVIGFPRQAAGLRHNSVAVLD-GGRVIAIRDKVDLPNYGEF 129 Query: 115 D-RRYFTPGDRTAPVIDYAGVRIAMLICYDVEFPENV-RAAALAGADLVAVPTAQMQPY- 171 D +R F G+ PV ++ GVRI + +C D+ V A +GA+++ P PY Sbjct: 130 DEKRVFDAGEMPGPV-NFRGVRIGIPVCEDIWGDLGVCETLAESGAEILLSPNG--SPYY 186 Query: 172 --EFIAEHLLRVR-AWENQIYIAYVNHDGDEGSLRYVGRS 208 + H + +R E + + Y N G + L + G S Sbjct: 187 RGKVDVRHQVVLRQVIETGLPMIYANQLGGQDELVFDGAS 226 Lambda K H 0.321 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 560 Length adjustment: 30 Effective length of query: 237 Effective length of database: 530 Effective search space: 125610 Effective search space used: 125610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory