Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate SMa1400 SMa1400 acyl-CoA dehydrogenase
Query= BRENDA::Q3JP94 (395 letters) >FitnessBrowser__Smeli:SMa1400 Length = 380 Score = 152 bits (385), Expect = 1e-41 Identities = 113/373 (30%), Positives = 177/373 (47%), Gaps = 8/373 (2%) Query: 18 LADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQYGGPGL 77 L + + VRD A A+A + P R E A ++ EM ++GL G +PE GGPG Sbjct: 3 LTEIQGQVRDMARAFADEVIRPMAESLDREERFPAELYGEMAKLGLFGIGVPEHLGGPGF 62 Query: 78 DYVSYGLIAREVERVDSGYRSMMSVQS--SLVMVPIFEFGSDAQKEKYLPKLATGEWIGC 135 D ++Y ++ E+ R GY S+ L+ + G++ Q ++ LP + Sbjct: 63 DTLTYAVVMEELSR---GYASVADQCGLVELISTLLVRHGTEGQ-QRMLPDVLNMSAKVA 118 Query: 136 FGLTEPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLD-EDGRDEIR 194 + +TEP G+D + T A + G+ L+G K+WI N+P+ADV V A+ D E G + Sbjct: 119 YCITEPEAGTDVSGIRTTAERDGDGWMLNGGKIWIHNAPVADVGFVLARTDKEAGNRGMS 178 Query: 195 GFILEKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENIL-PHVKGLRGPFTCLNSA 253 FI++ G+ K+G RAS G + + +P +L +G + L+ Sbjct: 179 IFIVDLNSAGVERGPKEHKMGQRASQVGALTFTDVRLPGGALLGQEGRGFHMMMSVLDKG 238 Query: 254 RYGIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGVLRL 313 R GIA A+G A++ A Y RKQFG+ ++ Q +Q LADM +I V Sbjct: 239 RVGIAALAVGIAQAGLEAAVDYAGTRKQFGKAISDFQGVQWLLADMAKDIEAARLLVHSA 298 Query: 314 GRMKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVNTY 373 D G A + SI K + A+ A + GG+G F V R + ++ Y Sbjct: 299 ASKIDRGLDATKACSIAKCFAGDMAVQRTADAVQVFGGSGYIRGFEVERLYRDAKITQIY 358 Query: 374 EGTHDIHALILGR 386 EGT+ I +I+ R Sbjct: 359 EGTNQIQRMIIAR 371 Lambda K H 0.320 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 380 Length adjustment: 30 Effective length of query: 365 Effective length of database: 350 Effective search space: 127750 Effective search space used: 127750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory