Align gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate SMa1415 SMa1415 aldehyde dehydrogenase
Query= reanno::pseudo6_N2E2:Pf6N2E2_4383 (497 letters) >FitnessBrowser__Smeli:SMa1415 Length = 498 Score = 372 bits (956), Expect = e-107 Identities = 209/483 (43%), Positives = 296/483 (61%), Gaps = 20/483 (4%) Query: 23 FINGEYTDAVSGETFDCL-SPVDGRLLGKIASCDVADAQRAVENARATFSSGVWSRLAPS 81 F++G++ SG F SP G + + A C V D AV AR F WS L Sbjct: 20 FVDGKWQ---SGHDFFVRHSPGHGVAVTRTAKCSVDDLNAAVAAARRAFEDRRWSGLPGG 76 Query: 82 KRKATMIRFAGLLKQHAEELALLETLDMGKPISDSLN-ID------VPGAAQALSWSGEA 134 R + ++R A +L+ +ELA ETL+ GKPI+ + ID GA A G++ Sbjct: 77 SRASVLLRVAEILRTRRDELAYWETLENGKPIAQARGEIDHCIACFEVGAGAARLLHGDS 136 Query: 135 IDKLYDEVAATPHDQLGLVTREPVGVVGAIVPWNFPLMMACWKLGPALSTGNSVVLKPSE 194 + L D + G+V REP+GVVG I PWNFP ++ C ++ L++G ++V+KPSE Sbjct: 137 FNSLGDGL-------FGMVLREPIGVVGLITPWNFPFLILCERVPFILASGCTMVVKPSE 189 Query: 195 KSPLTALRIAALAIEAGIPKGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMI 254 + T L +A + EAG+P GV NV+ G G T+G+A++ H D+D L FTGST + + + Sbjct: 190 VTSATTLILAEVLAEAGLPDGVYNVITGSGRTIGQAMSEHPDIDMLSFTGSTAVGRSCVH 249 Query: 255 YSGESNMKRIWLEAGGKSPNIVFADAPDLQAAAESAASAIAFNQGEVCTAGSRLLVERSI 314 + +SN K++ LE GGK+P IVFAD+ DL+ AA+ AA I+FN G+ C + SRL+VERS+ Sbjct: 250 AAADSNFKKLGLELGGKNPIIVFADS-DLEDAADGAAFGISFNTGQCCVSSSRLIVERSV 308 Query: 315 KDTFLPLVIEALKGWKPGNPLDPATNVGALVDTQQMNTVLSYIEAGHSDGAKLVAGGKRI 374 F L+ E +K + G+PLD T VGA+ Q T+L YI G ++GA+LV GG I Sbjct: 309 AREFEALLAEKMKRIRVGDPLDETTQVGAITTEAQNTTILDYIAKGKTEGAELVTGGTAI 368 Query: 375 LEETGGTYVEPTIFDGVSNAMKIAQEEIFGPVLSVIAFDTAEQAIEIANDTPYGLAAAVW 434 + G Y+ PT+F GVS M IA++EIFGPVL + FDT EQA+E+ANDT YGLAA+VW Sbjct: 369 -DLGRGQYIAPTLFSGVSREMAIARDEIFGPVLCSMTFDTVEQAVELANDTVYGLAASVW 427 Query: 435 TKDISKAHLTAKALRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHAFDKYTELKSTW 494 TK+I KA + +RAG WVN G P GGFKQSG GR+ ++ ++YT++KS Sbjct: 428 TKNIDKALTVTRRVRAGRFWVNTMMAGGPEMPLGGFKQSGWGREAGMYGVEEYTQVKSVH 487 Query: 495 IKL 497 +++ Sbjct: 488 VEI 490 Lambda K H 0.316 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 584 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 498 Length adjustment: 34 Effective length of query: 463 Effective length of database: 464 Effective search space: 214832 Effective search space used: 214832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory