Align arginase subunit (EC 3.5.3.1) (characterized)
to candidate SMc03091 SMc03091 arginase
Query= metacyc::MONOMER-11552 (324 letters) >FitnessBrowser__Smeli:SMc03091 Length = 307 Score = 312 bits (799), Expect = 8e-90 Identities = 156/308 (50%), Positives = 213/308 (69%), Gaps = 4/308 (1%) Query: 18 LKTCQILGAPVQSGASQPGCLMGPDAFRTAGLTQVLTELGWAVTDLGDATPTVEPELS-H 76 +KT ++GAP++ G+ + G MGP A R AG+ VL ELG V D GD P +L+ H Sbjct: 1 MKTITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVNDEGDLRPLPARDLANH 60 Query: 77 PNSAVKNLDALVGWTRSLSQKALEMARSCDLPVFLGGDHSMSAGTVSGVAQRTAELGKEQ 136 P + NL ++ + R+L + + AR P+ LGGDH++S G+VSG+A+ ++G+ Sbjct: 61 PGA--NNLQSVAAFARALDEAVHDTARKGHFPIILGGDHALSMGSVSGMARHAQDVGRPL 118 Query: 137 FVLWLDAHTDLHTLHTTASGNLHGTPVAYYTGQSGFEGLPPLAAP-VNPRNVSMMGIRSV 195 FVLWLDAH D ++ T+ SGN+HG PVA++ G++ F + P P V+P+ V +GIRSV Sbjct: 119 FVLWLDAHADFNSPATSPSGNMHGMPVAFFCGEAEFAPILPKDRPLVDPKKVYQVGIRSV 178 Query: 196 DPEERRRVAEIGVQVADMRVLDEQGVVRPLEAFLDRVSKVSGRLHVSLDVDFLDPAIAPA 255 D ER +AE GV V DMR +DE G+ + +D V +G LHVSLDVDF+DP +AP Sbjct: 179 DAREREEIAEHGVNVFDMRAIDEMGMAHIIRQIVDEVRAANGLLHVSLDVDFMDPELAPG 238 Query: 256 VGTTVPGGATFREAHLIMEMLHDSGLVTSLDLAELNPFLDERGRTARLITDLASSLFGRR 315 VGTTVPGGATFREAHLIME+L DSGLV+SLD+ ELNPFLD+RG++AR++ +L +SLFGRR Sbjct: 239 VGTTVPGGATFREAHLIMEVLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRR 298 Query: 316 VFDRVTTA 323 + DR T A Sbjct: 299 ILDRPTRA 306 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 307 Length adjustment: 27 Effective length of query: 297 Effective length of database: 280 Effective search space: 83160 Effective search space used: 83160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate SMc03091 SMc03091 (arginase)
to HMM TIGR01229 (rocF: arginase (EC 3.5.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01229.hmm # target sequence database: /tmp/gapView.29639.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01229 [M=300] Accession: TIGR01229 Description: rocF_arginase: arginase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-97 310.5 0.0 7e-97 310.3 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc03091 SMc03091 arginase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc03091 SMc03091 arginase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 310.3 0.0 7e-97 7e-97 2 298 .. 6 298 .. 5 300 .. 0.96 Alignments for each domain: == domain 1 score: 310.3 bits; conditional E-value: 7e-97 TIGR01229 2 ivglpfseGqgkrGvdkGpkalreaglleklkdlekevedlgqvaaaklekesdreavkaersvlaakeklaekv 76 ++g+p++eG g+rG +Gp+alr ag+ + l +l+++v+d g+++ + ++ + ++++sv a ++l e+v lcl|FitnessBrowser__Smeli:SMc03091 6 LIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVNDEGDLRPLPARDLANHPGANNLQSVAAFARALDEAV 80 79*******************************************888888889********************* PP TIGR01229 77 kkvveekrfplvLggdHsiaiGtvsgvakkakdk..klgvlwlDAHaDintletstSgnlHGmPlafllgrlkke 149 + +++++fp++LggdH++ +G+vsg+a++a+d l+vlwlDAHaD+n + ts+Sgn+HGmP+af+ g+ e lcl|FitnessBrowser__Smeli:SMc03091 81 HDTARKGHFPIILGGDHALSMGSVSGMARHAQDVgrPLFVLWLDAHADFNSPATSPSGNMHGMPVAFFCGE--AE 153 *********************************7669*********************************4..44 PP TIGR01229 150 v.edleelkllkgkeispkklvyiGlRdvdegErkilkelgikvfsmkeidklGiakvvektleslkaed.pihl 222 + + l++ ++ ++pkk+ +G+R+vd+ Er+ + e+g++vf+m++id++G+a+++++ +++++a + ++h+ lcl|FitnessBrowser__Smeli:SMc03091 154 FaPILPK---DRP-LVDPKKVYQVGIRSVDAREREEIAEHGVNVFDMRAIDEMGMAHIIRQIVDEVRAANgLLHV 224 5357777...788.8*****************************************************9999*** PP TIGR01229 223 SlDvDglDpklapatGtpvrgGltfrEgklilelllesglltaldlvEvNPtldikeksetikaavelvesllge 297 SlDvD++Dp+lap++Gt+v+gG+tfrE++li+e l +sgl+++ld+vE+NP+ld ++++ ++ vel++sl+g+ lcl|FitnessBrowser__Smeli:SMc03091 225 SLDVDFMDPELAPGVGTTVPGGATFREAHLIMEVLCDSGLVSSLDVVELNPFLD--DRGKSARILVELTASLFGR 297 ******************************************************..99***************98 PP TIGR01229 298 t 298 lcl|FitnessBrowser__Smeli:SMc03091 298 R 298 6 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (300 nodes) Target sequences: 1 (307 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.29 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory