Align Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 (characterized)
to candidate SMc01802 SMc01802 agmatinase
Query= SwissProt::Q7X3P1 (306 letters) >FitnessBrowser__Smeli:SMc01802 Length = 318 Score = 231 bits (590), Expect = 1e-65 Identities = 122/267 (45%), Positives = 169/267 (63%), Gaps = 2/267 (0%) Query: 38 VITGVPFDMATSGRAGTRHGPGAIRQISTNLAWEGHRWPWHFDMRERLKVVDCGDLVFNF 97 V+ G+PFD ATS R G R GP AIR+ S + ++P+ D+ + +D GD + ++ Sbjct: 45 VVWGIPFDAATSNRPGARFGPQAIRRASA-IFDNDPQYPFQRDLFADMATIDYGDCLLDY 103 Query: 98 GDAQDMSDKLQAHTEKLLAAGKRCLTFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTY 157 G+ ++ K+L +G LT GGDHFVT P+LRAHA G +ALV FDAH DT+ Sbjct: 104 GNHARTPQTIEREASKILKSGAYLLTLGGDHFVTYPILRAHAALHGPLALVQFDAHQDTW 163 Query: 158 ANGS-KFDHGTMFYHAPNEGLIDPQHSVQIGIRTEHDTNNGFTVLDAAQVNDRGVDDLVA 216 + + DHG A EGLID + S+QIGIRT + G ++ ++ + +++ Sbjct: 164 PDEKGRIDHGAFVGRAAREGLIDVERSIQIGIRTHAPEDCGIRIVYGYELEEMRAEEIAD 223 Query: 217 QIKEIVGSLPVYLTFDIDCLDPAFAPGTGTPVVGGLTTDKALKMLRALQPLNIVGMDLVE 276 I V + P YLTFDIDCLDPAFAPGTGTPV GG ++ K L +LR L L+I G D+VE Sbjct: 224 TIIRHVDNRPAYLTFDIDCLDPAFAPGTGTPVAGGPSSAKILSVLRKLGALHIAGSDVVE 283 Query: 277 VSPAYDQSDITALAGATIALDMLYLQA 303 V+PAYD +D+TA+AG+TIA+ ML L+A Sbjct: 284 VAPAYDHADLTAIAGSTIAMYMLGLRA 310 Lambda K H 0.321 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 318 Length adjustment: 27 Effective length of query: 279 Effective length of database: 291 Effective search space: 81189 Effective search space used: 81189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate SMc01802 SMc01802 (agmatinase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.1961.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-70 223.3 0.0 2.7e-70 223.1 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc01802 SMc01802 agmatinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc01802 SMc01802 agmatinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 223.1 0.0 2.7e-70 2.7e-70 11 274 .. 40 307 .. 29 308 .. 0.92 Alignments for each domain: == domain 1 score: 223.1 bits; conditional E-value: 2.7e-70 TIGR01230 11 eeAevvivgiPydattsyrpGsrhgpeaireastnLeaysee.ldrdlal.lkvvDagdlplaaGdaremvekie 83 + e+v+ giP+da+ts rpG+r+gp+air as ++ ++ ++rdl + +D gd l +G++ + ++ie lcl|FitnessBrowser__Smeli:SMc01802 40 KGVEAVVWGIPFDAATSNRPGARFGPQAIRRASAIFDNDPQYpFQRDLFAdMATIDYGDCLLDYGNHARTPQTIE 114 55799*****************************99987654488998555************************ PP TIGR01230 84 evveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlr....defegeklshacvmrrvlelgl 154 +++++l+ g ++++GG+H++t+p++rA++ +++la+vqfDAH D+ +++ + ++ +++++ lcl|FitnessBrowser__Smeli:SMc01802 115 REASKILKSGAYLLTLGGDHFVTYPILRAHAALHGPLALVQFDAHQDTWpdekGRIDHGAFVGRAAREGLIDVE- 188 ************************************************95433456777777777788888887. PP TIGR01230 155 nvlqigiRsgikeeadlarennikvlkreledeiaevlakvldkpvyvtiDiDvlDPafaPGvgtpepgGltske 229 +++qigiR+ e+ ++ + ++ ++ e+ ++ + +v ++p y+t+DiD+lDPafaPG+gtp++gG +s + lcl|FitnessBrowser__Smeli:SMc01802 189 RSIQIGIRTHAPEDCGIRIVYGYELEEMRAEEIADTIIRHVDNRPAYLTFDIDCLDPAFAPGTGTPVAGGPSSAK 263 9***********************9999999999999999*********************************** PP TIGR01230 230 llklfvlaekekkvvGlDvvEvaPvydssevtaltaaklalelll 274 +l +++ + ++ G DvvEvaP+yd++++ta++ +++a+ +l+ lcl|FitnessBrowser__Smeli:SMc01802 264 ILS-VLRKLGALHIAGSDVVEVAPAYDHADLTAIAGSTIAMYMLG 307 ***.7788999*****************************99985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (318 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.70 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory