Align ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)
to candidate SMa0489 SMa0489 ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4773 (244 letters) >FitnessBrowser__Smeli:SMa0489 Length = 255 Score = 275 bits (702), Expect = 8e-79 Identities = 141/244 (57%), Positives = 177/244 (72%), Gaps = 2/244 (0%) Query: 1 MISIKSINKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDIVV 60 MI + + K +G F+ L S EV++GE IV+CGPSGSGKSTLI+C+N +E G I++ Sbjct: 14 MIQLIGVGKRFGQFEALKQVSLEVRRGEKIVLCGPSGSGKSTLIRCINRMEEHTSGRIII 73 Query: 61 DGTSIADPKTNLPKLRSRVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATKKGLQL 120 DG + D ++ +R VGMVFQ F LFPH+TI +NLTIAQ V ++EA + + Sbjct: 74 DGRELTDRTKDINAVRREVGMVFQSFNLFPHMTILKNLTIAQRLVRKTPEKEAKEVAMHY 133 Query: 121 LERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDVMV 180 L+RV + A K+P QLSGGQQQRVAIARAL M P +MLFDEPTSALDPEM++EVLDVMV Sbjct: 134 LKRVKIPEQASKYPVQLSGGQQQRVAIARALCMKPQIMLFDEPTSALDPEMISEVLDVMV 193 Query: 181 QLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFFGDINARAERTQHFLNK 240 LA +GMTM+CVTHEMGFAR VADRV+FMD G++IE+ E FF N R ERT FL + Sbjct: 194 DLARDGMTMICVTHEMGFARSVADRVMFMDGGQLIEEGDPETFFA--NPRNERTALFLRQ 251 Query: 241 ILQH 244 IL+H Sbjct: 252 ILRH 255 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 255 Length adjustment: 24 Effective length of query: 220 Effective length of database: 231 Effective search space: 50820 Effective search space used: 50820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory