Align ATPase (characterized, see rationale)
to candidate SMc03135 SMc03135 amino-acid transport system ATP-binding ABC transporter protein
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__Smeli:SMc03135 Length = 251 Score = 297 bits (761), Expect = 1e-85 Identities = 152/252 (60%), Positives = 190/252 (75%), Gaps = 3/252 (1%) Query: 10 PVTAIASAPETMIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLN 69 P + ++PE I GV KWYG Q+ AL ++L++ E VV+ GPSGSGKST +R +N Sbjct: 2 PTSIDIASPE--ITLSGVHKWYG-QYHALDDINLSIASREKVVICGPSGSGKSTLIRCVN 58 Query: 70 ALESHQRGEIWIEGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRW 129 LE+HQ+G I + G + D R + IR+EVGMVFQQFNLFPHLT+L+N +LAP+ V+R Sbjct: 59 RLEAHQQGRIVVGGVEVGEDERKVDAIRREVGMVFQQFNLFPHLTILENCILAPMWVKRM 118 Query: 130 PVAQAEATARQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALD 189 P AQA A L RVRI EQA+KYPGQLSGGQQQRVAIARAL M P+++LFDEPTSALD Sbjct: 119 PRAQATEIAMDYLNRVRIPEQANKYPGQLSGGQQQRVAIARALCMNPKVMLFDEPTSALD 178 Query: 190 PEMVREVLDVMRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQ 249 PEMV+EVLD M LA++GMTM+ THE+GFAR+VADRV+ M G+IVEE PD FF P+ Sbjct: 179 PEMVKEVLDTMVALANDGMTMVCVTHEMGFARQVADRVIFMDQGRIVEEGEPDEFFAHPK 238 Query: 250 SDRAKQFLAQIL 261 +DRA FL+Q+L Sbjct: 239 TDRASLFLSQLL 250 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 251 Length adjustment: 24 Effective length of query: 237 Effective length of database: 227 Effective search space: 53799 Effective search space used: 53799 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory