Align BztA, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate SMc02118 SMc02118 general L-amino acid-binding periplasmic ABC transporter protein
Query= TCDB::Q52663 (338 letters) >FitnessBrowser__Smeli:SMc02118 Length = 341 Score = 388 bits (996), Expect = e-112 Identities = 196/330 (59%), Positives = 237/330 (71%), Gaps = 3/330 (0%) Query: 11 ALAALVAGAASASTLDDVKARGQLICGSNPGLTGFAAPDANGVYQGFDVAVCKAVAAAVL 70 A+ + AASA+TLDDVKA+G + CG N GL GFAAPDA+G + GFDV CKA+AAA+ Sbjct: 13 AVVGIGTHAASAATLDDVKAKGFVQCGVNTGLAGFAAPDASGNWSGFDVDYCKAIAAAIF 72 Query: 71 GDPMKVKYVPLTGETRFTALASGEVDVLVRNSTWTFSRDTELALDFVAVNYYDGQGFMVN 130 GD KVKY PL+ + RF AL SGEVDVL RN+TW+ +RDT L +F VNYYDGQGFMV Sbjct: 73 GDGSKVKYTPLSAKERFPALQSGEVDVLARNTTWSINRDTALGFNFRPVNYYDGQGFMVR 132 Query: 131 KSLGVSSAKELDGATICVQTGTTTEMNLADFFKANNMTYTPVNIADDAEGQQKFAAGACD 190 K L V SA EL GA +CVQTGTTTE+NLAD+FKANN+ Y PV E + AG CD Sbjct: 133 KELDVKSALELSGAAVCVQTGTTTELNLADYFKANNLQYNPVVFEKLEEVNAAYDAGRCD 192 Query: 191 SYTTDASGLASSRATLPNAADIVILPEIISKEPLGPVVRHGDNNWGDIVRWSFYALVAAE 250 YTTD SGL S R TL D ++LPEIISKEPL P VR GD+ W DIV W YALV AE Sbjct: 193 VYTTDQSGLYSLRLTLSKPDDHIVLPEIISKEPLAPAVRQGDDQWFDIVSWVHYALVQAE 252 Query: 251 EYGITKANLEEVAASTQNPEIRRLLGLEGD--MGKKIGLDNDFAKRAILASGNYGEVFEA 308 E+G+T+ANLEE+ ST NP+++R LG+E D +G +GL N++A + A GNYGEVF+ Sbjct: 253 EFGVTQANLEEMKKST-NPDVQRFLGVEADSKIGTDLGLTNEWAVNIVKAVGNYGEVFDR 311 Query: 309 NIGASTSIGLARGLNAQWTQGGLMYAPPFR 338 NIGA + + + RGLNA W +GGL YAPP R Sbjct: 312 NIGAGSPLKIERGLNALWNKGGLQYAPPVR 341 Lambda K H 0.316 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 341 Length adjustment: 28 Effective length of query: 310 Effective length of database: 313 Effective search space: 97030 Effective search space used: 97030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory