Align NatF, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)
to candidate SMc02118 SMc02118 general L-amino acid-binding periplasmic ABC transporter protein
Query= TCDB::Q8YPM9 (369 letters) >FitnessBrowser__Smeli:SMc02118 Length = 341 Score = 338 bits (866), Expect = 2e-97 Identities = 171/340 (50%), Positives = 226/340 (66%), Gaps = 7/340 (2%) Query: 32 TACGGDSAPTTDTSTNSGSTLVANRWNTIKNRGQLICGVSGEVPGFSFVGTDGEYSGIDV 91 TA G + T S +TL + +K +G + CGV+ + GF+ G +SG DV Sbjct: 7 TALVGAAVVGIGTHAASAATL-----DDVKAKGFVQCGVNTGLAGFAAPDASGNWSGFDV 61 Query: 92 DVCRAIAAALFDNPDAVEFRNLSAKERFTALQTGEVDILSRNTTWTLSRATSVGLEFAPV 151 D C+AIAAA+F + V++ LSAKERF ALQ+GEVD+L+RNTTW+++R T++G F PV Sbjct: 62 DYCKAIAAAIFGDGSKVKYTPLSAKERFPALQSGEVDVLARNTTWSINRDTALGFNFRPV 121 Query: 152 VFYDGQAIMVRKNSAIKSLADLKDKAICVQTGTTTEQNLADQMRKRNITYKPVVFEDVNV 211 +YDGQ MVRK +KS +L A+CVQTGTTTE NLAD + N+ Y PVVFE + Sbjct: 122 NYYDGQGFMVRKELDVKSALELSGAAVCVQTGTTTELNLADYFKANNLQYNPVVFEKLEE 181 Query: 212 TFATYAEGRCDAITADRSALVSRRTTLPTPEDNVVLDEVISSEPLAPAVARGDAKWSNTV 271 A Y GRCD T D+S L S R TL P+D++VL E+IS EPLAPAV +GD +W + V Sbjct: 182 VNAAYDAGRCDVYTTDQSGLYSLRLTLSKPDDHIVLPEIISKEPLAPAVRQGDDQWFDIV 241 Query: 272 NWVVYALIKGEELGINAQNLGQFTTSNDPDVKRFLGTEGD--LGQGLGLTNDFAARIIKH 329 +WV YAL++ EE G+ NL + S +PDV+RFLG E D +G LGLTN++A I+K Sbjct: 242 SWVHYALVQAEEFGVTQANLEEMKKSTNPDVQRFLGVEADSKIGTDLGLTNEWAVNIVKA 301 Query: 330 VGNYAEVYDRNLGPKTKLNLARGQNQLWSKGGLLYSPPFR 369 VGNY EV+DRN+G + L + RG N LW+KGGL Y+PP R Sbjct: 302 VGNYGEVFDRNIGAGSPLKIERGLNALWNKGGLQYAPPVR 341 Lambda K H 0.317 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 341 Length adjustment: 29 Effective length of query: 340 Effective length of database: 312 Effective search space: 106080 Effective search space used: 106080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory