GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aapQ in Sinorhizobium meliloti 1021

Align AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate SMc02119 SMc02119 general L-amino acid transport permease ABC transporter protein

Query= TCDB::Q52813
         (400 letters)



>FitnessBrowser__Smeli:SMc02119
          Length = 397

 Score =  551 bits (1419), Expect = e-161
 Identities = 269/381 (70%), Positives = 324/381 (85%)

Query: 20  SAMYDPKYRSIFYQILTIVILVGFVWWVAHNTAVNLARSNTASGFGFLRGRAGFEIGQSL 79
           S + DP+ R IFYQ +TI+IL   ++W+  NT  NL R+N ASG+ F+R RAGF++GQSL
Sbjct: 17  SIINDPQVRGIFYQAITIIILAALIYWIVDNTVDNLRRANIASGYDFVRSRAGFDVGQSL 76

Query: 80  ITFSSDSTYARALLVGILNTLLVAVTGIFTATIIGFLIGIGRLSRNWLIAKLCTVYVEVF 139
           I+F+SDSTY RALLVG +NTLLVA+TGI TATIIGF++GIGRLS NW+IAKL   YVEVF
Sbjct: 77  ISFTSDSTYGRALLVGFINTLLVAITGIITATIIGFIVGIGRLSHNWIIAKLSLAYVEVF 136

Query: 140 RNIPPLLVIFFWYLGVLSVLPQPRESVGLPFSMYLNNRGLAFPKPIFDTGMIAVGIALVI 199
           RNIPPLLVIFFWY GVLS+LPQ R+++ LPF ++L+NRG+AFP+PI + G     +A VI
Sbjct: 137 RNIPPLLVIFFWYSGVLSILPQARDALALPFDIFLSNRGVAFPRPIAEEGAEYTLLAFVI 196

Query: 200 AIVASIIIARWAHKRQAATGQPFHTVWTAIALIVGLPLLVFVVSGFPLTFDVPVAGKFNL 259
           A+ AS+  AR+A KRQ ATG+    +WT + LI+GLPL+ F+V+G P+TFD+PVAGKFNL
Sbjct: 197 AVAASVFFARYARKRQLATGERLPVLWTVLGLIIGLPLVTFLVTGAPITFDIPVAGKFNL 256

Query: 260 TGGSVVGPEFMSLFLALSFYTASFIAEIVRGGIRGVPKGQSEAAGALGLHPSSVTRLVVV 319
           TGGSVVGPEFMSLFLALSFYTA+FIAEIVR GIRGV KGQ+EAA ALG+ P+  TRLVVV
Sbjct: 257 TGGSVVGPEFMSLFLALSFYTAAFIAEIVRAGIRGVSKGQTEAAHALGIRPALTTRLVVV 316

Query: 320 PQALRIIIPPLTSQYLNLTKNSSLAIAIGFSDLVAVGGTILNQSGQAIEIVCIWGIVYLS 379
           PQA+RIIIPPLTSQYLNLTKNSSLA+AIG++DLVAVGGTILNQ+GQ+IEIV IW IVYLS
Sbjct: 317 PQAMRIIIPPLTSQYLNLTKNSSLAVAIGYADLVAVGGTILNQTGQSIEIVSIWLIVYLS 376

Query: 380 LSILTSLFMNWFNAKMALVER 400
           LS+ TSLFMNW+NA+MALVER
Sbjct: 377 LSLATSLFMNWYNARMALVER 397


Lambda     K      H
   0.327    0.141    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 642
Number of extensions: 32
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 397
Length adjustment: 31
Effective length of query: 369
Effective length of database: 366
Effective search space:   135054
Effective search space used:   135054
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory