Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 2 (characterized)
to candidate SMc03133 SMc03133 amino-acid transport system permease ABC transporter protein
Query= reanno::pseudo3_N2E3:AO353_16285 (248 letters) >FitnessBrowser__Smeli:SMc03133 Length = 323 Score = 108 bits (270), Expect = 1e-28 Identities = 67/211 (31%), Positives = 116/211 (54%), Gaps = 17/211 (8%) Query: 28 GLGWTIAIAIVAWIIALMLGSVLGVMRTVPNRLVSGIATCYVELFRNVPLLVQLFIWYFL 87 G+ T+ I++++ +A ++ V + + N ++ G+AT Y LFR +PLL+Q++I Y Sbjct: 121 GVVTTLYISVISIAVATVIALVGAIAKLSKNGVIYGLATFYTSLFRGLPLLMQIYIIYLG 180 Query: 88 VPDLLPQNLQDWYKQDLNPTTSAYLSVVVCLGLFTAARVCEQVRTGIQALPRGQESAARA 147 +P + SA + ++ L L A + E R GI+++PRGQ A A Sbjct: 181 LPQV-------------GYVISAVPAGILALSLCYGAYMTEIFRAGIESIPRGQTEGATA 227 Query: 148 MGFKLPQIYWNVLLPQAYRIVIPPLTSEFLNVFKNSSVASLIGLMEL--LAQTKQTAEFS 205 +G Q V+LPQA R++IPP ++F+ + K+SS+ S++G+ EL LA+T+ EF Sbjct: 228 LGLSPSQTMGLVILPQAMRVIIPPTGNQFIAMLKDSSLISVVGVWELMYLARTQGQTEF- 286 Query: 206 ANLFEAFTLATLIYFTLNMSLMLLMRMVEKK 236 E A++IY+ L++ L + VE + Sbjct: 287 -RHIEMLITASMIYWILSIGLEYMQSRVEAR 316 Lambda K H 0.326 0.139 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 323 Length adjustment: 26 Effective length of query: 222 Effective length of database: 297 Effective search space: 65934 Effective search space used: 65934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory