GapMind for catabolism of small carbon sources

 

Aligments for a candidate for natG in Sinorhizobium meliloti 1021

Align NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)
to candidate SMc03865 SMc03865 amino-acid transport system permease ABC transporter protein

Query= TCDB::Q8YPM8
         (308 letters)



>lcl|FitnessBrowser__Smeli:SMc03865 SMc03865 amino-acid transport
           system permease ABC transporter protein
          Length = 273

 Score =  117 bits (292), Expect = 4e-31
 Identities = 75/227 (33%), Positives = 129/227 (56%), Gaps = 11/227 (4%)

Query: 82  GLINSLRIAFVGIILTTIVGILAGIARLSDNWLVRNISLVYVEIFRNTPLLLQLLFWYFA 141
           GL  ++ +  VG +L T++G+   +  LS++ ++R I+  Y E+ R  P+L+ L   ++ 
Sbjct: 49  GLGVTVFVTLVGFVLATVLGLGVALMALSEHVVLRQIARFYTEVIRGVPILVLL---FYI 105

Query: 142 VFLGLPRADNKISLGGFIG--LSQNGLELPWFT--FSPEFSALLLGLIFYTGAFIAEIVR 197
            F+G P     +++  F+   L   G   P+     S  + A++  +I Y+ AFIAE+ R
Sbjct: 106 AFVGAPAL---VTVANFVAAPLISAGWIEPFVVRDVSLMWRAIMALMIGYS-AFIAEVFR 161

Query: 198 GGIQSVSKGQWEAGRSLGLNPSLIMRLVIFPQALRVIIPPLTSQYLNLTKNSSLAIAIGY 257
            GIQSV KGQ EA ++LGL+     RLV+FPQA+RVI+PPL + ++ + K+SSL   +G 
Sbjct: 162 AGIQSVDKGQVEAAKALGLSRYQRFRLVVFPQAIRVILPPLGNDFVAMVKDSSLVSVLGV 221

Query: 258 PDIYFVASTTFNQTGKAVEVMLLLMLTYLSLSLTISLIMNAFNRTVQ 304
            DI  +     + + +  E   ++   YL L++ +SL + A  R ++
Sbjct: 222 ADITQMGKVYASGSFRFFETYSIVAYVYLVLTIGLSLALRAVERRLR 268


Lambda     K      H
   0.328    0.143    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 194
Number of extensions: 7
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 308
Length of database: 273
Length adjustment: 26
Effective length of query: 282
Effective length of database: 247
Effective search space:    69654
Effective search space used:    69654
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory