Align NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)
to candidate SMc03865 SMc03865 amino-acid transport system permease ABC transporter protein
Query= TCDB::Q8YPM7 (381 letters) >FitnessBrowser__Smeli:SMc03865 Length = 273 Score = 121 bits (303), Expect = 3e-32 Identities = 82/261 (31%), Positives = 139/261 (53%), Gaps = 34/261 (13%) Query: 144 PWLSLIWLLSFPIILWLIGGGFGLRPVSSNLWN----GLLLTLLMAAISIVLSFPIGVLL 199 PW WL++ +I + + + ++ GL +T+ + + VL+ +G+ + Sbjct: 16 PW----WLIALLVIAAALAAVIAANDIFTQVFTVVLKGLGVTVFVTLVGFVLATVLGLGV 71 Query: 200 ALGRTSNLPVVRWFSILYIEIVRGVPLIGILFLAQ-------------VMLPL------- 239 AL S V+R + Y E++RGVP++ +LF V PL Sbjct: 72 ALMALSEHVVLRQIARFYTEVIRGVPILVLLFYIAFVGAPALVTVANFVAAPLISAGWIE 131 Query: 240 -FFAADVRLDRVLRAIAGLVLFSAAYMAENVRGGLQAVSRGQVEAAKALGLNTFFVVLLI 298 F DV L + RAI L++ +A++AE R G+Q+V +GQVEAAKALGL+ + L+ Sbjct: 132 PFVVRDVSL--MWRAIMALMIGYSAFIAEVFRAGIQSVDKGQVEAAKALGLSRYQRFRLV 189 Query: 299 VLPQALRAVIPALVGQFIGLFKDTSLLSLVGLVELTGIARSILAQPQFIGRYAEVYLFIG 358 V PQA+R ++P L F+ + KD+SL+S++G+ ++T + + + A F R+ E Y + Sbjct: 190 VFPQAIRVILPPLGNDFVAMVKDSSLVSVLGVADITQMGK-VYASGSF--RFFETYSIVA 246 Query: 359 LIYWLFCYSMSLASRRLERQL 379 +Y + +SLA R +ER+L Sbjct: 247 YVYLVLTIGLSLALRAVERRL 267 Lambda K H 0.332 0.145 0.452 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 273 Length adjustment: 28 Effective length of query: 353 Effective length of database: 245 Effective search space: 86485 Effective search space used: 86485 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory