Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate SM_b21605 SM_b21605 sugar uptake ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc04256 (361 letters) >FitnessBrowser__Smeli:SM_b21605 Length = 362 Score = 330 bits (845), Expect = 5e-95 Identities = 174/362 (48%), Positives = 238/362 (65%), Gaps = 7/362 (1%) Query: 1 MTSVSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQI 60 M+ + + +S +FGAV V+ ++++I GEF V +G SGCGKSTLL IAGL + + G+I Sbjct: 1 MSGIKLTGVSKSFGAVKVIHGVDIEIGQGEFAVFVGPSGCGKSTLLRMIAGLEETTGGEI 60 Query: 61 FIKDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEI 120 I +VT +EP RG+ MVFQSYALYP ++V N++F L +A+ P AEIE++VK A+EI Sbjct: 61 RIDAEDVTHKEPSKRGVAMVFQSYALYPHLSVFDNMAFSLSIARRPKAEIEQKVKAAAEI 120 Query: 121 LQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLH 180 L++ L KPS+LSGGQRQRVAIGRA+VR+ VFLFDEPLSNLDA+LR ++R+EI RLH Sbjct: 121 LRLSDYLDSKPSQLSGGQRQRVAIGRAIVREPRVFLFDEPLSNLDAELRVKMRMEIARLH 180 Query: 181 QSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMN 240 + + TM+YVTHDQ+EA+TLADRI V+K+GV+QQ P+ +Y P+N+FVAGFIGSP MN Sbjct: 181 RQIGATMVYVTHDQVEAMTLADRIVVLKAGVVQQTGAPLELYRNPDNMFVAGFIGSPGMN 240 Query: 241 FFRGEVEPKDGRSFV----RAGGIAFDVTAYPAHTRLQPGQKVVLGLRPEHVKVDEARDG 296 F + V P G A G+ F++ PA T G+++ +G+RPEH+ + E G Sbjct: 241 FLKARVVPGSGDRLTIELHDAPGVPFEI---PARTGPAVGEEIFVGVRPEHITLGEREGG 297 Query: 297 EPTHQAVVDIEEPMGADNLLWLTFAGQSMSVRIAGQRRYPPGSTVRLSFDMGVASIFDAE 356 IEE G L LT G+ M++ G+ R P VRL+ F+ Sbjct: 298 VGLDVTAEFIEELGGTGYLHALTVTGEEMTIECRGEERPQPKQAVRLTLAPEEMFAFEGS 357 Query: 357 SE 358 E Sbjct: 358 GE 359 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 362 Length adjustment: 29 Effective length of query: 332 Effective length of database: 333 Effective search space: 110556 Effective search space used: 110556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory