Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate SMa2309 SMa2309 ABC transporter permease
Query= reanno::Smeli:SMc04257 (305 letters) >FitnessBrowser__Smeli:SMa2309 Length = 273 Score = 162 bits (409), Expect = 1e-44 Identities = 93/281 (33%), Positives = 158/281 (56%), Gaps = 12/281 (4%) Query: 26 SRRNIIVYGTLIVVALYYLLPLYVMIVTSLKGMPEIRVGNIFAPPLEITFEPWVKAWAEA 85 +R + V G ++++ +L PL+ +I+TS + M ++ GN++ P EI V+ + Sbjct: 4 ARLYMTVVGAILII---WLAPLFAVILTSFRSMADVMSGNLWGWPTEIAV---VENYTAV 57 Query: 86 CTGLNCDGLSRGFWNSVRITVPSVIISIAIASVNGYALANWRFKGADLFFTILIVGAFIP 145 T G F NS+ IT+PSVI ++++++ G+ LA +RF G + F + + G F+P Sbjct: 58 FTQTPMAGY---FLNSLVITIPSVIGVLSLSTLAGFVLARYRFPGNMVIFALFVGGNFLP 114 Query: 146 YQVMIYPIVIVLREMGVYGTLTGLIIVHTIFGMPILTLLFRNYFAGLPEELFKAARVDGA 205 +Q+M+ P+ ++ + +Y T T LII H F TL RN+ A LP+ELF+AAR +GA Sbjct: 115 HQIMMIPVRDLMVRLNLYDTTTALIIFHVAFQTGFATLFMRNFIAALPDELFQAARAEGA 174 Query: 206 GFWTIYFKIMLPMSLPIFVVAMILQVTGIWNDFLFGVVFT-RPEYYPMTVQLNNIVNSVQ 264 + +++P+ P + IL T IWND+ + VV T P+T L N+ + Sbjct: 175 TPFQTLIHVVVPLVRPAWAALAILLFTFIWNDYFWAVVLTVSDNVKPVTAGLANLRG--E 232 Query: 265 GVKEYNVNMAATILTGLVPLTVYFVSGRLFVRGIAAGAVKG 305 V +N+ A TI+ + P+ ++F+ + F+ G+ GAVKG Sbjct: 233 WVSAWNLISAGTIIVAVPPVVMFFLMQKHFIAGLTMGAVKG 273 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 273 Length adjustment: 26 Effective length of query: 279 Effective length of database: 247 Effective search space: 68913 Effective search space used: 68913 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory