Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate SMc03063 SMc03063 alpha-glucoside ABC transporter permease
Query= reanno::Smeli:SMc04257 (305 letters) >FitnessBrowser__Smeli:SMc03063 Length = 380 Score = 141 bits (355), Expect = 3e-38 Identities = 81/224 (36%), Positives = 124/224 (55%), Gaps = 9/224 (4%) Query: 89 LNCDGLSRGFWNSVRITVPSVIISIAIASVNGYALANWRFKGADLFFTILIVGAFIPYQV 148 L+ G+ R F NS+ + VPS +I I IA+ YALA F G + +++ +P Q+ Sbjct: 158 LSAAGIGRSFLNSLTVAVPSTVIPILIAAFAAYALAWMPFPGRAVLLAVVVGLLVVPLQM 217 Query: 149 MIYPIVIVLREMGVY-----GTLTGLIIVHTIFGMPILTLLFRNYFAGLPEELFKAARVD 203 + P++ + +G + T G+ + HT FG+P+ L RNY AGLP E+ ++ARVD Sbjct: 218 SLIPLLQLYNGVGAFFGVSAKTYMGIWLAHTGFGLPLAIYLLRNYMAGLPREIMESARVD 277 Query: 204 GAGFWTIYFKIMLPMSLPIFVVAMILQVTGIWNDFLFGVVF--TRPEYYPMTVQLNNIVN 261 GA + I+ KI+LP+S P I Q WND L +VF + +T +L N++ Sbjct: 278 GASDFDIFVKIILPLSFPALASFAIFQFLWTWNDLLVAIVFLGAGDDKLVLTGRLVNLLG 337 Query: 262 SVQGVKEYNVNMAATILTGLVPLTVYFVSGRLFVRGIAAGAVKG 305 S G + + A+ +T +VPL V+F R VRG+ AG+VKG Sbjct: 338 SRGG--NWEILTASAFITIVVPLIVFFALQRYLVRGLLAGSVKG 379 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 380 Length adjustment: 28 Effective length of query: 277 Effective length of database: 352 Effective search space: 97504 Effective search space used: 97504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory