Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate SMc04394 SMc04394 ABC transporter permease
Query= reanno::Smeli:SMc04257 (305 letters) >FitnessBrowser__Smeli:SMc04394 Length = 293 Score = 284 bits (726), Expect = 2e-81 Identities = 142/288 (49%), Positives = 193/288 (67%), Gaps = 3/288 (1%) Query: 21 PRRTLSRRNI---IVYGTLIVVALYYLLPLYVMIVTSLKGMPEIRVGNIFAPPLEITFEP 77 P +S + ++Y LI+ ALY LLPLYVM+V SLK + EIR G + P T EP Sbjct: 6 PENVISHNRLTRALIYSALILFALYSLLPLYVMLVNSLKPLDEIRQGGMLNLPQTWTVEP 65 Query: 78 WVKAWAEACTGLNCDGLSRGFWNSVRITVPSVIISIAIASVNGYALANWRFKGADLFFTI 137 W+ AW+ A G+ GL F NS+ + VP+V IS I ++NGY L WRF GA++FF + Sbjct: 66 WLSAWSTAQIGVQPTGLRPFFINSILMVVPAVAISTIIGALNGYVLTKWRFPGANIFFGM 125 Query: 138 LIVGAFIPYQVMIYPIVIVLREMGVYGTLTGLIIVHTIFGMPILTLLFRNYFAGLPEELF 197 L++ FIP+Q+++ P+ +L +G+ G++ GLI+VH ++G+ TL FRNY+ P EL Sbjct: 126 LLLSCFIPFQIVLIPMARILGILGIAGSIWGLILVHVVYGIGFTTLYFRNYYEAFPTELV 185 Query: 198 KAARVDGAGFWTIYFKIMLPMSLPIFVVAMILQVTGIWNDFLFGVVFTRPEYYPMTVQLN 257 +AA++DGA F+ I+ +I+LP S PI VV++I Q T IWNDFLFG F+ P PMTV LN Sbjct: 186 RAAQIDGASFFQIFRRILLPSSGPIIVVSVIWQFTNIWNDFLFGASFSGPYSTPMTVALN 245 Query: 258 NIVNSVQGVKEYNVNMAATILTGLVPLTVYFVSGRLFVRGIAAGAVKG 305 N+V+S GVKEYNV+ A IL L L VY VSGR FVRG+ +GAVKG Sbjct: 246 NLVSSSTGVKEYNVHFAGAILAALPTLIVYIVSGRYFVRGLMSGAVKG 293 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 293 Length adjustment: 27 Effective length of query: 278 Effective length of database: 266 Effective search space: 73948 Effective search space used: 73948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory