Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate SMa1370 SMa1370 ABC transporter ATP-binding protein
Query= TCDB::Q9WXN4 (268 letters) >FitnessBrowser__Smeli:SMa1370 Length = 327 Score = 180 bits (456), Expect = 4e-50 Identities = 102/257 (39%), Positives = 149/257 (57%), Gaps = 5/257 (1%) Query: 11 KIFSLGFFSKRR-IEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPPTSGEIYF 69 ++ S G F KRR + AV +VSF++ E + LVGESGSGKTT + +LR +P G I F Sbjct: 17 ELSSGGLFRKRRSVNAVSDVSFDLAPGETLGLVGESGSGKTTVGRAVLRRIPAAQGRIVF 76 Query: 70 EGKDIWKDIKDRESLVEFRRKVHAVFQDPFASYNPFYPVERTLWQAISLLENKPSNKKEA 129 G+DI E L R ++ V QDP+ S NP V + + + ++ ++ +EA Sbjct: 77 GGEDITH--LGGEPLRRLRARMQIVLQDPYTSLNPRMKVSSIVAEPL-IVHGLAASAEEA 133 Query: 130 LELIKESLFRVGIDPKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADEPTSMIDASS 189 + E L RVG+ P D +YPH SGGQ+QRI IAR L+P LIVADEP S +D S Sbjct: 134 RAAVAELLERVGL-PGDAADRYPHSFSGGQRQRIGIARALALKPALIVADEPVSALDVSV 192 Query: 190 RGGIIKLLEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVERGHPDKVVLEPTHE 249 R ++ L+++L+ + G S +FI HDL + ++S + +M G IVE D + P H Sbjct: 193 RAQVVNLMQDLQRDLGISYLFIAHDLAIVRHISHRVAIMYAGRIVEIAPRDAIYQRPIHP 252 Query: 250 YTKLLVGSIPKLYRKLE 266 YT+ L+ ++P KL+ Sbjct: 253 YTEALLSAVPVANPKLQ 269 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 327 Length adjustment: 26 Effective length of query: 242 Effective length of database: 301 Effective search space: 72842 Effective search space used: 72842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory