Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate SMa2079 SMa2079 ABC transporter ATP-binding protein
Query= TCDB::Q9WXN5 (330 letters) >FitnessBrowser__Smeli:SMa2079 Length = 314 Score = 189 bits (480), Expect = 8e-53 Identities = 118/319 (36%), Positives = 173/319 (54%), Gaps = 15/319 (4%) Query: 5 LLKAENVRAYYKLEKVSVKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLT 64 L+ A N++ +YK +++VDG+ + E +G+VGESGCGK+TL + + +V P Sbjct: 3 LISASNLKTHYKTRDGLLRSVDGVDLVVERGETVGLVGESGCGKSTLGKTL-LRLVDPTA 61 Query: 65 LVDGKIFLRVNGEFVELSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVRHLAE 124 G+I EF D+ + + K I +I Q +L P + + + Sbjct: 62 ---GRI------EFKGEDITALDQGRLRNVRKSIQMIFQDPFASLNPRHTIGEILEAPLI 112 Query: 125 SHGIDEE-ELLDKARRRFEEVGLDPLWIKRYPFELSGGMRQRAVIAIATILNPSLLIADE 183 H E +VGL I RYP E SGG RQR IA A +LNP L++ DE Sbjct: 113 VHQAGSPPERRSTVASIVAKVGLPADAINRYPHEFSGGQRQRIGIARALLLNPELIVCDE 172 Query: 184 PTSALDVVNQKVLLKVLMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIVEFAPV 243 P SALD+ Q +L +L++MK++ S +FI+HD++ VR DR+++MY G++VE A Sbjct: 173 PVSALDLSIQAQILNLLVEMKKE-FGLSYLFISHDLSVVRYFCDRVLVMYLGRVVESADN 231 Query: 244 ESLLEKPLHPYTQGLFNSVLTPEPEVKKRGITTIPGAPPNLINPPSGCRFHPRCPHAMDV 303 E+L P HPYT+ L +V P+P + R + G P+ N P GCRFH RCP A ++ Sbjct: 232 ETLWSDPRHPYTRALMAAV--PDPS-RPRQAAPLGGELPSPSNIPPGCRFHTRCPLATEL 288 Query: 304 CKEKEPPLTEIEPGRRVAC 322 C+ EP I+PG RVAC Sbjct: 289 CRVAEPEFRSIKPGHRVAC 307 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 314 Length adjustment: 28 Effective length of query: 302 Effective length of database: 286 Effective search space: 86372 Effective search space used: 86372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory