Align TM0030, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate SMa0467 SMa0467 ABC transporter permease
Query= TCDB::Q9WXN7 (338 letters) >FitnessBrowser__Smeli:SMa0467 Length = 338 Score = 178 bits (451), Expect = 2e-49 Identities = 121/336 (36%), Positives = 174/336 (51%), Gaps = 20/336 (5%) Query: 2 GSKSMFKYLLRRFIFLLVTYIVATTIVFILPRAIPGNPLSQILSGLSRVAQANPEAIRAA 61 G S+ ++ RRF + ++ + VF L PG+P+S +L A+A+ A AA Sbjct: 19 GGSSLVVFITRRFAVTIPLLLIISFGVFALIHIAPGDPVSSLLG-----ARASDPATLAA 73 Query: 62 ERTLMEEFGLGKPWYVQYFEFITKALRGDLGTSITFYPRKVIDLIIPVIPWTLILLLPAT 121 R + L VQY ++++ +RGDLG SI R V I + T+ L L +T Sbjct: 74 IRA---RYHLDDSLLVQYGTWLSQVIRGDLGVSI-LGNRSVTSTIADRLGVTIFLSLMST 129 Query: 122 IVAWILGNSLGALAAYKRNTWIDKGVLTTSLIVSQIPYYWLGMIFIFLFGVKLGWLPVQG 181 + LG LGALAA++R T +D+ V+ S+ P + G+ F+++FGV L W P G Sbjct: 130 TLVLGLGILLGALAAFRRGTGLDRTVVMFSVFGISSPAFVTGIFFLYVFGVLLHWFPTFG 189 Query: 182 AYSQGTIPNLSWSFFVDVLKHYIMPFASIVVSAMGGWAIGMRLMVIYELGSDYAMFSEYL 241 A GT F+D H +P ++ S M R VI EL DY F+ Sbjct: 190 A---GT-------GFLDRAWHLALPALALAASTMAIVVKITRAAVIEELARDYVTFARAR 239 Query: 242 GMKDKRIF-KYVFRNSLLPQITGLALSLGGVLGGALITEIVFNYPGTGYLLFRALTTLDY 300 G+ +RI YV RNSL+P IT L + G+L GA+ E+ F+ PG G L+ A+ D Sbjct: 240 GVSSRRILLAYVLRNSLIPVITAAGLIVIGILAGAIYVEVTFSLPGLGALMIDAVQKRDI 299 Query: 301 PLIQGIFVILIASIYLANFIVDFLYALIDPRIRLGQ 336 P IQGI ++ A + L N VD +Y LIDPRIR G+ Sbjct: 300 PTIQGITLLFSAFVVLVNLAVDVIYTLIDPRIRFGR 335 Lambda K H 0.329 0.146 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 338 Length adjustment: 28 Effective length of query: 310 Effective length of database: 310 Effective search space: 96100 Effective search space used: 96100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory