Align 6-P-β-glucosidase (CelF;CelD;LicH;BSU38560) (EC 3.2.1.86) (characterized)
to candidate SM_b21648 SM_b21648 alpha-galactosidase (melibiase) protein
Query= CAZy::CAA90288.1 (442 letters) >FitnessBrowser__Smeli:SM_b21648 Length = 490 Score = 135 bits (341), Expect = 2e-36 Identities = 133/463 (28%), Positives = 218/463 (47%), Gaps = 45/463 (9%) Query: 6 KIVTIGGGS-SYTPELVEGFIKRYDELPVRELWLVDIPEGEEKLNIVGTLAKRMVEKAGV 64 KI IG GS +T +L + EL E L D+ E L ++ ++ R+VE + Sbjct: 5 KIAIIGAGSIGFTKKLFTDILS-VPELRDVEFALTDL--SEHNLAMIKSILDRIVEANEL 61 Query: 65 PIDIHLTLDRRKALKDADFVTTQFRVGLLQARAKDERIPLKYGV---IGQETNGPGGLFK 121 P + T DRRKAL+ A ++ + RVG L+A A D RIPLKYGV +G +T GG+ Sbjct: 62 PTRVTATTDRRKALEGARYIISCVRVGGLEAYADDIRIPLKYGVDQCVG-DTICAGGILY 120 Query: 122 GLRTIPVILEIAKDIEELC-PNAWLVNFTNPAGMVTEALLRYSNLKKVVGLCNVPIGIKM 180 G R IPVIL+ KDI E+ P A +N+ NP M T A + Y + VGLC+ G++ Sbjct: 121 GQRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKV-DTVGLCH---GVQH 176 Query: 181 G---VAKALDVDVDRVEVQFAGLNHMVFGLDVFLDGVSVKEQVIEAMGDPKNAMTMKNIS 237 G +A+ L ++ +G+NH + +DV L+G V + + A + + + Sbjct: 177 GAEQIAEILGARDGELDYICSGINHQTWFVDVRLNGRKVGKDELVAAFEAHPVFSKQE-- 234 Query: 238 GAEWEPDFLKALNVIP-------CGYHRYYFKTKEMLEHELEAS-----QTEG---TRAE 282 + D LK V Y +Y K + + ++ S +T G E Sbjct: 235 --KLRIDVLKRFGVYSTESNGHLSEYLPWYRKRPDEISRWIDMSDWIHGETGGYLRYSTE 292 Query: 283 VVQKVEKELFELYKDPNLAIKPPQLEKRGGAYYSDAACNLISSIYNDKHDIQPVNTINNG 342 E E ++ A +P + +R ++ A ++ ++ + N NNG Sbjct: 293 TRNWFETEYPRFLEE---AGRPLETIRRS----NEHASRILEALETGRVYRGHFNVKNNG 345 Query: 343 AIASIPDDSAVEVNCVMTKTGPKPIAVGDLPVSVRGLVQQIKSFERVAAEAAVTGDYQTA 402 I ++P D+ +E + + G +A LP + + +R++ AA+TGD Sbjct: 346 VITNLPADAIIESPGFVDRFGINMVAGITLPEACAATCISSVNVQRMSVHAAITGDIDLL 405 Query: 403 LLAMTINPLVPSDTVAK---QILDEMLEAHKAYLPQFFNKIEA 442 LA+ +PLV + + Q++DEM+ A +LPQ+ + I+A Sbjct: 406 KLAVLHDPLVGAICTPEEVWQMVDEMVVAQAKWLPQYAHAIDA 448 Lambda K H 0.318 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 442 Length of database: 490 Length adjustment: 33 Effective length of query: 409 Effective length of database: 457 Effective search space: 186913 Effective search space used: 186913 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory