Align CbtC, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate SM_b21198 SM_b21198 oligopeptide uptake ABC transporter permease
Query= TCDB::Q97VF6 (290 letters) >FitnessBrowser__Smeli:SM_b21198 Length = 376 Score = 107 bits (267), Expect = 4e-28 Identities = 69/238 (28%), Positives = 120/238 (50%), Gaps = 6/238 (2%) Query: 52 TIFMPPQLSNFYLIFGTGPFAESILVQIIQGAKSVIEISFLAGLFATLIGIVVGIIAGYL 111 T+ + +++ Y FGT +LV+++ G + I + LA L + IG+V G +GY+ Sbjct: 144 TLKVEGEVAREYFPFGTDSNGRDLLVRVMLGGQISIAVGLLASLVSLGIGVVYGATSGYI 203 Query: 112 GGIIDNILMGITDIILTLPSLILIIIIVSAFKTSNPIFLSLILSITSWAGLARAVRSQVL 171 GG +DN++M + +I+ +LP + L++++V F S I + L++ W +AR VR Q L Sbjct: 204 GGRVDNVMMRLVEILYSLPFVFLVVVLVVFFGRSF-ILIFLVIGAVEWLDMARIVRGQTL 262 Query: 172 VIRNSPAVEVLRVLGLSRKYIIFREVVPTLGSYIAIHYIFNVEAAVYAEVGLYYLGVLPY 231 ++ V + LGL+ II R ++P + + V + E L +LG+ Sbjct: 263 ALKRREFVGAAQALGLTDWQIIRRHIIPNTIGPVIVFVTVVVPKVILLESFLSFLGLGVQ 322 Query: 232 NP-NNWGAMIQQALSYGAAAGGKAIYYLAFPTIVVAGFMSGLILLSYGIDEISNPRIR 288 P +WGA+I S GA A + L FP I + L + G+ + +P+ R Sbjct: 323 APLTSWGALI----SEGANNIQSAPWLLIFPAIFFVVTLFSLNFVGDGLRDALDPKDR 376 Lambda K H 0.328 0.146 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 376 Length adjustment: 28 Effective length of query: 262 Effective length of database: 348 Effective search space: 91176 Effective search space used: 91176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory