Align CBP protein aka CebG, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate SM_b20233 SM_b20233 sugar ABC transporter permease
Query= TCDB::Q9X9R5 (276 letters) >FitnessBrowser__Smeli:SM_b20233 Length = 282 Score = 141 bits (356), Expect = 1e-38 Identities = 85/268 (31%), Positives = 139/268 (51%), Gaps = 16/268 (5%) Query: 15 VVLTVFALVSLAPLVWTAIAASRTNHRLAETPPPLWFGGNLFKNLEAAWEQAGLGTA--- 71 VV + A ++L PL+W A + P F NL + T Sbjct: 24 VVTAILAFMTLFPLLWIVSIAFK--------PAAESFSSNLIPQAPTLDNFIYVLTGVPF 75 Query: 72 ---MLNSVIVAGTITVSTVLFSTLAGFAFAKLRFRFSGLLLLLTIGTMMIPPQLAVVPLY 128 M+NS +V+ T+TV + F T+AG+A A+LRF ++ L T ++ + +VPL+ Sbjct: 76 IRYMVNSFLVSATVTVVALFFHTMAGYALARLRFPGREVMFLSIFSTFLVSLPVIIVPLF 135 Query: 129 LWMSDLGWSNQLHTVILPSLVTAFGTFFMRQYLVQALPTELIEAARVDGASSLRIVWHVV 188 + + +G N +I+P++ AFG F +RQY + +LP E+ EAAR+DGA RI W V+ Sbjct: 136 VIVKAMGMLNSYAGLIIPAIFNAFGIFLLRQYYL-SLPKEIEEAARIDGAGYWRIYWSVI 194 Query: 189 FPAARPAMAVLGLLTFVFAWNDFLWPI-IALNQQNPTVQVGPELARHRVLPDQAVIMAGA 247 P +RP M+ L +L F+ WN FLWP+ I + VQ+G + + +MA + Sbjct: 195 LPLSRPIMSALAILFFLANWNSFLWPLTITSDPDLWVVQLGIANFKSQYSASWNYMMAAS 254 Query: 248 LLGTLPLLVAFLLFGKQIVGGIMQGAIK 275 + +P L+ F++F +QI+ + +K Sbjct: 255 TIVAIPTLILFVIFQRQIMDSLKTSGLK 282 Lambda K H 0.327 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 282 Length adjustment: 26 Effective length of query: 250 Effective length of database: 256 Effective search space: 64000 Effective search space used: 64000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory