Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate SMc02835 SMc02835 glucokinase
Query= curated2:B9JYQ5 (340 letters) >FitnessBrowser__Smeli:SMc02835 Length = 339 Score = 457 bits (1177), Expect = e-133 Identities = 225/338 (66%), Positives = 268/338 (79%), Gaps = 1/338 (0%) Query: 4 PHDNDH-MPFPVLVGDIGGTNARFWILMDAHAAPKEFANIHTADFPTIDQAIQDCILDKS 62 P+ ++H PFP+L+GDIGGTNARF +L DA+ PK+ A I T DF TI++A+Q ILDK+ Sbjct: 2 PNASEHSFPFPILIGDIGGTNARFALLTDAYGEPKQLAPIRTGDFATIEEAMQKGILDKT 61 Query: 63 GFQPRSAILAVAGPIKDDEIPLTNCPWVIRPKAMIADLGFDDVLVVNDFEAQALAAASLG 122 QPRSAILAVAGPIK DEIPLTN WVIRPK M+A LG +DVLV+NDFEAQALA A+ Sbjct: 62 SVQPRSAILAVAGPIKGDEIPLTNAGWVIRPKDMLAGLGLEDVLVINDFEAQALAIAAPA 121 Query: 123 RNDREPIGPLTETSLNSRVILGPGTGLGVGGLLYTHHTWFPVPGEGGHVDIGPRSDRDWQ 182 D IG +SRV+LGPGTGLGV GL+Y HTW PVPGEGGHVDIGPR++RD++ Sbjct: 122 DQDVVQIGGGAVRPFHSRVVLGPGTGLGVAGLVYAQHTWIPVPGEGGHVDIGPRTERDFR 181 Query: 183 IFPHIERIEGRISGEQILCGRGILHLYNAICAADGIEPVWTDPADVTQHALKGNDPVCVE 242 I+P +E IEGR++GEQILCGRGI++LY A+CAA+G E V D A VT AL G D VE Sbjct: 182 IWPFLEPIEGRMAGEQILCGRGIMNLYRAVCAANGEEAVLADQAAVTTSALSGADAAAVE 241 Query: 243 TMTLFVTYLGRIAGDMALVFMARGGVFLSGGISQKIIPLLKSPVFRAAFEDKAPHTEMMK 302 T++LF TYLGR+AGDMAL+FMARGGVFL+GGISQKI+P L P FRAAFEDKAPH+ +M+ Sbjct: 242 TVSLFATYLGRVAGDMALIFMARGGVFLAGGISQKILPALTKPEFRAAFEDKAPHSALMR 301 Query: 303 TIPTFVAIHPQAALSGLAAYARTPSSYGVKHEGRRWQR 340 TIPTF IHP AALSGLAA+ARTP +GV EGRRW+R Sbjct: 302 TIPTFAVIHPMAALSGLAAFARTPRDFGVAMEGRRWRR 339 Lambda K H 0.322 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 339 Length adjustment: 28 Effective length of query: 312 Effective length of database: 311 Effective search space: 97032 Effective search space used: 97032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate SMc02835 SMc02835 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.27389.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-73 232.6 0.1 4.1e-73 232.3 0.1 1.0 1 lcl|FitnessBrowser__Smeli:SMc02835 SMc02835 glucokinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc02835 SMc02835 glucokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 232.3 0.1 4.1e-73 4.1e-73 1 313 [. 14 317 .. 14 319 .. 0.95 Alignments for each domain: == domain 1 score: 232.3 bits; conditional E-value: 4.1e-73 TIGR00749 1 lvgdiGGtnarlalvevapgeieqvktyssedfpsleavvrv.yleeakvelkdpikgcfaiatPiigdfvrltn 74 l+gdiGGtnar+al+ a ge +q+ ++ df +e++++ l+++ v+ p + +a+a+Pi gd + ltn lcl|FitnessBrowser__Smeli:SMc02835 14 LIGDIGGTNARFALLTDAYGEPKQLAPIRTGDFATIEEAMQKgILDKTSVQ---PRSAILAVAGPIKGDEIPLTN 85 79**********************************999987255655554...5679***************** PP TIGR00749 75 ldWalsieelkqelalaklelindfaavayailalkeedliqlggakveesaaiailGaGtGlGvatliqqsdgr 149 W + +++ l+l+ + +indf a+a+ai+a ++d++q+gg v + + +lG+GtGlGva l+ ++ lcl|FitnessBrowser__Smeli:SMc02835 86 AGWVIRPKDMLAGLGLEDVLVINDFEAQALAIAAPADQDVVQIGGGAVRPFHSRVVLGPGTGLGVAGLVY-AQHT 159 *********************************************************************9.9*** PP TIGR00749 150 ykvlageGghvdfaPrseleillleylrkkygrvsaervlsGsGlvliyealskrkgerevsklskeelkekdis 224 + ++geGghvd Pr e ++ ++ +l gr++ e++l G G++++y+a+ ++ge+ v l + ++ lcl|FitnessBrowser__Smeli:SMc02835 160 WIPVPGEGGHVDIGPRTERDFRIWPFLEPIEGRMAGEQILCGRGIMNLYRAVCAANGEEAV--LA----DQAAVT 228 *****************************99*************************98865..44....45679* PP TIGR00749 225 eaalegsdvlarralelflsilGalagnlalklgarGGvyvaGGivPrfiellkkssfraafedkGrlkellasi 299 +al g d+ a ++++lf + lG++ag++al + arGGv++aGGi ++++ l k fraafedk +l+ +i lcl|FitnessBrowser__Smeli:SMc02835 229 TSALSGADAAAVETVSLFATYLGRVAGDMALIFMARGGVFLAGGISQKILPALTKPEFRAAFEDKAPHSALMRTI 303 *************************************************************************** PP TIGR00749 300 PvqvvlkkkvGllG 313 P v++ + l G lcl|FitnessBrowser__Smeli:SMc02835 304 PTFAVIHPMAALSG 317 *******9998887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (339 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.56 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory