Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate SM_b20352 SM_b20352 sugar ABC transporter permease
Query= TCDB::G4FGN4 (313 letters) >FitnessBrowser__Smeli:SM_b20352 Length = 354 Score = 241 bits (616), Expect = 1e-68 Identities = 132/312 (42%), Positives = 195/312 (62%), Gaps = 16/312 (5%) Query: 14 FLILIAIVVFLGVTTREFLTVENIFTVILNVSFIAIMSFGMTMVIITSGIDLSVGSILGA 73 F+ L A+V F + FL+ N+ + +V+ A ++ GMT VIIT GIDLSVGSI+G Sbjct: 28 FIALFAVVAFFSIFAPNFLSTANLILMSKHVALNAFLAMGMTFVIITGGIDLSVGSIVGL 87 Query: 74 ASVVMG-LLMD----EKGLSPFLSVV----IGLAVGVGFGLANGLLITKARLAPFISTLG 124 +V G L+++ + G + + +VV I LAVG+ G NGLLITK +APFI+TLG Sbjct: 88 CGMVAGGLILNGIDLQFGYTVYFNVVEVCLITLAVGIVIGAVNGLLITKLNVAPFIATLG 147 Query: 125 MLSVGRGLAYVMSGGWPISPF---PE----SFTVHGQGMVGPVPVPVIYMAVIGVIAHIF 177 L V RG A + SGG PE F G G + +PV + + V+ + A Sbjct: 148 TLYVARGFALLSSGGQTFPNLVGKPELATTGFAFLGSGRLLGLPVSIWVLIVVALAAAYV 207 Query: 178 LKYTVTGRRIYAIGGNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLTAWLGVAQPNA 237 +YT GR I+A+GGN A+++ GI+ DR+ + VY +GF AA G ++++ L + P Sbjct: 208 ARYTPIGRHIFAVGGNERAARMSGIRVDRVKMFVYMFSGFCAAIVGLVISSELMASHPAT 267 Query: 238 GQGYELDVIAATVIGGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQVVIGIV 297 G +EL+ IAA V+GGTS+SGG GTI G +GA ++G+L +G++++G+SSFWQ V+ GIV Sbjct: 268 GNSFELNAIAAAVLGGTSMSGGRGTIGGTIIGAFVIGILSDGLVMMGISSFWQMVIKGIV 327 Query: 298 IIIAIAIDQIRR 309 II+A+ +DQ +R Sbjct: 328 IIVAVVVDQAQR 339 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 354 Length adjustment: 28 Effective length of query: 285 Effective length of database: 326 Effective search space: 92910 Effective search space used: 92910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory