Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate SMc04137 SMc04137 ABC transporter permease
Query= uniprot:A3DHA2 (303 letters) >FitnessBrowser__Smeli:SMc04137 Length = 295 Score = 142 bits (359), Expect = 7e-39 Identities = 90/287 (31%), Positives = 146/287 (50%), Gaps = 25/287 (8%) Query: 24 FGVYVILIVITVVLLFPILFTIANSFMSDKEVLDTYQKKIEEVEEGESTEFLGFKLIPDM 83 F V+ LI ++ +++P+L+ I+ S + E+ F L P Sbjct: 26 FLVHAALIAASIAMIYPLLWMISASVRPEDEI------------------FASTSLWPSS 67 Query: 84 VSMKQYYTVLFRKP-TFLLMFLNSAIMTIPIVIIQVIVGVFAAYAFAKLRFPLRDKLFFV 142 V Y F +F F NS ++ + V+ V+ AAYAFA+LRF R+ F + Sbjct: 68 VDFSSYVRGWFGLDVSFGRFFWNSLVIAVLTVVGNVVACSLAAYAFARLRFAGRNFWFAI 127 Query: 143 FIVVMLMPLQVTLVPNYILLRKLDMIGSFLSVILPGGFS--AFGVVLLRQYMRGIPDECC 200 + M++P VTL+P Y+L L + +FL +++P + AF + L+ Q+ RGIP E Sbjct: 128 MLGTMMIPYHVTLIPQYVLFLDLGWVNTFLPLVVPKFLASDAFFIFLMVQFFRGIPRELD 187 Query: 201 EAAMIDGAGYLKTFTKIILPQCKSIIASLAILAFIDNWNMVEQPLIFLSDSAKYP----L 256 EAAM+DG G + + KI+LP ++A+ AI +FI W+ PLI+L+D Y L Sbjct: 188 EAAMMDGCGAWRIYWKIMLPLSLPVLATAAIFSFIWTWDDFFGPLIYLNDMNSYTIQLGL 247 Query: 257 SVYLAYINEGDLGLAFASGVLYMIPTVLIYLYGEKYFVEGIQLTGIK 303 ++ + D G FA L ++P +L+ ++ +EGI TG+K Sbjct: 248 RTFVDSSSTSDWGGLFAMSTLSLVPVFFFFLFFQRLLIEGIATTGMK 294 Lambda K H 0.331 0.147 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 295 Length adjustment: 27 Effective length of query: 276 Effective length of database: 268 Effective search space: 73968 Effective search space used: 73968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory