Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate SM_b21096 SM_b21096 amino acid transporter ABC transporter ATP-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >FitnessBrowser__Smeli:SM_b21096 Length = 256 Score = 237 bits (604), Expect = 2e-67 Identities = 125/242 (51%), Positives = 166/242 (68%), Gaps = 1/242 (0%) Query: 8 DLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLNNEEL 67 D+ K YG+ L VSL+ A G+V IIG SGSGKST LRCINLLE+ G I + +E + Sbjct: 11 DVTKNYGTFRALDKVSLEVARGEVSCIIGPSGSGKSTLLRCINLLERMDGGAIWVKDELI 70 Query: 68 KLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSKTEAR 127 + + + +D ++ R R R+ MVFQ FNL+ H TA+ENI+E PV VLG EAR Sbjct: 71 GYRRDGNNLHEISDA-EISRQRRRIGMVFQRFNLFPHKTALENIIEGPVQVLGEPVNEAR 129 Query: 128 EKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPELVGD 187 ++A L +VG+A + + YP +SGG+QQRVAIARA+ M P+++LFDEPTSALDPELV + Sbjct: 130 DRAAALLERVGLADKANHYPSELSGGQQQRVAIARAMGMRPDLILFDEPTSALDPELVSE 189 Query: 188 VLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSERLQQ 247 VL VM+ LA G TM+VVTHE+GFAR V+N + F+ G V E+G EVL P+S R + Sbjct: 190 VLDVMRDLAASGMTMIVVTHELGFARNVANTVTFMETGKVVETGLASEVLSTPKSARTAE 249 Query: 248 FL 249 F+ Sbjct: 250 FI 251 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 256 Length adjustment: 24 Effective length of query: 230 Effective length of database: 232 Effective search space: 53360 Effective search space used: 53360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory