Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate SMc02137 SMc02137 ornithine carbamoyltransferase
Query= BRENDA::Q98BB6 (303 letters) >FitnessBrowser__Smeli:SMc02137 Length = 303 Score = 470 bits (1209), Expect = e-137 Identities = 225/300 (75%), Positives = 257/300 (85%) Query: 4 RHFTDLSTVSEGDLRFMLDDAVVRKARLKAGERTRPLEGKVLAMIFDKPSTRTRVSFDVG 63 RHF DLS ++ DLR ++DDA VRK+ KAG +PL GK+LAMIF+KPSTRTRVSFDVG Sbjct: 3 RHFLDLSAMTATDLRTIIDDARVRKSATKAGTAEKPLAGKMLAMIFEKPSTRTRVSFDVG 62 Query: 64 MRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHDRLLELTENATVPVI 123 MRQLGGET+ L+GTEMQLGR+ETI DTAKVLSRYVDAIMIRTT H RLLE+ E+ATVPVI Sbjct: 63 MRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHRRLLEMAEHATVPVI 122 Query: 124 NGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARFRFNLNVAVP 183 NGLTDDTHPCQ+MADI+TFEEHRGPV GKTIAWTGDGNNVLHSL+E SARF + +N+AVP Sbjct: 123 NGLTDDTHPCQIMADILTFEEHRGPVKGKTIAWTGDGNNVLHSLIEGSARFGYRMNMAVP 182 Query: 184 EGSEPAQKHIDWSKAHGGKLHFTRSPEEAVDQADCVVTDCWVSMGQEHRARGHNVFSPYQ 243 GSEP K ++W++ +G ++ + E+AV A CVVTD W+SM QEHRARGHNVF PYQ Sbjct: 183 LGSEPHDKFLNWARNNGAEVLLSHEAEQAVAGAHCVVTDTWISMNQEHRARGHNVFQPYQ 242 Query: 244 VNAKLMAHAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQKAVLAWCLGA 303 VN LM HA PDALFMHCLPAHRGEEVTDEVIDGP SVVFDEAENRLHAQK++LAWC+GA Sbjct: 243 VNGALMKHAAPDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILAWCMGA 302 Lambda K H 0.320 0.133 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 303 Length adjustment: 27 Effective length of query: 276 Effective length of database: 276 Effective search space: 76176 Effective search space used: 76176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate SMc02137 SMc02137 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00658.hmm # target sequence database: /tmp/gapView.27497.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-119 383.7 0.0 3.3e-119 383.5 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc02137 SMc02137 ornithine carbamoyltran Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc02137 SMc02137 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 383.5 0.0 3.3e-119 3.3e-119 1 303 [. 3 300 .. 3 301 .. 0.98 Alignments for each domain: == domain 1 score: 383.5 bits; conditional E-value: 3.3e-119 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvlylnkee 75 rh+l+l ++ +l+++++ a+ k+++k+g+ ek l gk la+iFek+stRtRvsf+v++ +lG+++l+l+ e lcl|FitnessBrowser__Smeli:SMc02137 3 RHFLDLSAMTATDLRTIIDDARVRKSATKAGTAEKPLAGKMLAMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTE 77 8************************************************************************** PP TIGR00658 76 lqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDlltikeklgklkevk 150 +qlgr e+i Dta+vlsryvdai++R+++h+ + e+a++a+vPvingLtd +hPcqi+aD+lt +e+ g +k+ + lcl|FitnessBrowser__Smeli:SMc02137 78 MQLGRAETIGDTAKVLSRYVDAIMIRTTDHRRLLEMAEHATVPVINGLTDDTHPCQIMADILTFEEHRGPVKGKT 152 *************************************************************************** PP TIGR00658 151 lvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkleltedpkkavkdadviytDvw 225 +++ GD+nnv +sl+ ++a +G +++a P g ep+ + +++a+ +ng+++ l ++ ++av++a+ ++tD+w lcl|FitnessBrowser__Smeli:SMc02137 153 IAWTGDGNNVLHSLIEGSARFGYRMNMAVPLGSEPHDKFLNWAR----NNGAEVLLSHEAEQAVAGAHCVVTDTW 223 *****************************************995....6************************** PP TIGR00658 226 vsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdevlegeasivfdeaenRlhaqkavlk 300 +sm +e+++ ++++pyqvn l+++a p++ f+hCLPa+rGeevtdev++g++s+vfdeaenRlhaqk++l+ lcl|FitnessBrowser__Smeli:SMc02137 224 ISMNQEHRA-RGHNVFQPYQVNGALMKHAAPDALFMHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKSILA 297 ****99887.5679************************************************************9 PP TIGR00658 301 all 303 +++ lcl|FitnessBrowser__Smeli:SMc02137 298 WCM 300 987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (303 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.41 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory