Align Gamma-glutamyl-putrescine synthetase (EC 6.3.1.11) (characterized)
to candidate SMc01973 SMc01973 glutamine synthetase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_925 (458 letters) >FitnessBrowser__Smeli:SMc01973 Length = 455 Score = 331 bits (849), Expect = 3e-95 Identities = 171/445 (38%), Positives = 255/445 (57%), Gaps = 3/445 (0%) Query: 15 AFLKEHPEVLYVDLLIADMNGVVRGKRIERTSLHKVYEKGINLPASLFALDINGSTVEST 74 ++L+++ + + +I D+NG++RGKR+ KV GI +P S+ +D+ G + + Sbjct: 13 SWLEQNGPIESIQAVICDLNGIMRGKRVPVEQARKVLGGGIRMPLSIVGVDVWGEDIIGS 72 Query: 75 GLGLDIGDADRICYPIPDTLCNEPWQKRPTAQLLMTMHELEGEPFFADPREVLANVVRKF 134 GD D IC W RP+A + + + G PF ADPR+ LA ++R++ Sbjct: 73 AQVFATGDRDGICGVTGRGALPVNWTSRPSALVPLWLFVENGRPFLADPRQALAAIMREY 132 Query: 135 DEMGLTICAAFELEFYLIDQENVNGRPQPPRSPVSGKRPHSTQVYLIDDLDEYVDCLQDI 194 E+GL A ELEFYLID E + PP SP +GKR S + ID+LD++ + D+ Sbjct: 133 RELGLRPVVATELEFYLIDPEPDSA--VPPISPYTGKRLDSDAILSIDELDDFGEFFSDV 190 Query: 195 LEGAKEQGIPADAIVKESAPAQFEVNLHHVADPIKACDYAVLLKRLIKNIAYDHEMDTTF 254 Q +PADA + E+ QFE+NL H DP+KA D A+ KR++K +A H + TF Sbjct: 191 YRECARQNVPADAAIAENGIGQFEINLLHSDDPLKAADDAIFFKRIVKGVARKHGLAATF 250 Query: 255 MAKPYPGQAGNGLHVHISILDKDGKNIFASEDPEQNAALRHAIGGVLETLPAQMAFLCPN 314 MAKPY ++GNG+HVH S+LD++G N+F E +A L+HA+ G+L + P+ Sbjct: 251 MAKPYGTRSGNGMHVHFSLLDEEGNNVFDDGSDEGSAVLKHAVAGLLRGMAETTLMFAPH 310 Query: 315 VNSYRRFGAQFYVPNSPCWGLDNRTVAIRVPTGSADAVRIEHRVAGADANPYLLMASVLA 374 NSYRR + P S WG +NRT AIR+P G+ A RIEHRVAGADANPYL++A++L Sbjct: 311 FNSYRRLRPDTHAPTSISWGYENRTSAIRIPGGNPAARRIEHRVAGADANPYLVIAAILG 370 Query: 375 GVHHGLTNKIEPGAPVEGNSYEQNE-QSLPNNLRDALRELDDSEVMAKYIDPKYIDIFVA 433 G+ NK +P PVEG +Y + +P + A+ + + A+ DP + +A Sbjct: 371 AALVGIRNKWKPPVPVEGRAYAAEKLPKIPADWGQAVDAFEAGPIAAEIFDPVLRSMLIA 430 Query: 434 CKESELEEFEHSISDLEYNWYLHTV 458 CK E+ F ++D E++ YL V Sbjct: 431 CKRQEIAGFAEQVTDYEFSAYLEIV 455 Lambda K H 0.318 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 607 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 458 Length of database: 455 Length adjustment: 33 Effective length of query: 425 Effective length of database: 422 Effective search space: 179350 Effective search space used: 179350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory