Align gamma-glutamylputrescine oxidase (EC 1.4.3.-) (characterized)
to candidate SMc00761 SMc00761 oxidoreductase
Query= reanno::pseudo5_N2C3_1:AO356_21495 (427 letters) >FitnessBrowser__Smeli:SMc00761 Length = 428 Score = 214 bits (546), Expect = 3e-60 Identities = 137/421 (32%), Positives = 210/421 (49%), Gaps = 10/421 (2%) Query: 9 SYYAASANPVPPRPALQDDVETDVCVIGAGYTGLSSALFLLENGFKVTVLEAAKVGFGAS 68 S+Y A+ P P + + DV +IG GYTGL +A L +G VT+++A + G GAS Sbjct: 12 SWYEATIPERPVFPIMPGSRKADVAIIGGGYTGLQAACNLARSGTDVTLIDACRFGDGAS 71 Query: 69 GRNGGQIVNSYSRDIDVIERSVGPQQAQLLGNMAFEGGRIIRERVAKYQIQCDLKDG--- 125 GRNGGQ D E +G + AQ L +MA R + ++ I + G Sbjct: 72 GRNGGQFGTGQRVWADETEEVLGREWAQRLFDMAENAKRYVLGFAEEHAIDIEFMPGQLS 131 Query: 126 -GVFAALTAKQMGHLESQKRLWERFGHTQLELLDQRRIREVVACEEYVGGMLDMSGGHIH 184 G A+L H+E+ + R+G+ L +D+ + Y G+ D GHIH Sbjct: 132 VGHKASLERDYRNHVEA---MTGRYGYPHLSFMDREETVSRLGSSHYHFGIRDTGTGHIH 188 Query: 185 PLNLALGEAAAVESLGGVIYEQSPAVRIER-GASPVVHTPQGKVRAKFIIVAGNAYLGNL 243 P+ L +G A G +YE + A++IE+ G + V+ T G + A ++A N Y+GNL Sbjct: 189 PMKLVVGLARQAALAGANLYEGTKALKIEKKGGAVVIETTSGTITADRALIACNGYIGNL 248 Query: 244 VPELAAKSMPCGTQVIATEPLGDELAHSLLPQDYCVEDCNYLLDYYRLTGDKRLIFGGGV 303 P A+ MP + + AT L +LP V+D +++ Y+R + D RL+FGG Sbjct: 249 EPVTASHVMPIRSFIGATTVLHGH--PEILPGGESVDDSRFVVRYFRKSKDGRLLFGGRE 306 Query: 304 VYGARDPANIEAIIRPKMLKAFPQLKDVKIDYAWTGNFLLTLSRLPQVGRLGDNIYYSQG 363 Y A +P +I A IR ++ + +P L DV+I +AW G+ +T+ R P + + G Sbjct: 307 AYTADNPRDISAHIRRQICEIYPDLADVEITHAWGGSVGITMPRQPFCREVMPGVTTIGG 366 Query: 364 CSGHGVTYTHLAGKVLAEALRGQAERFDAFADLPHYPFPGGQLLRTPFAAMGAWYYGLRD 423 SGHGV + GK+ AE G++ D L FPGG R+ + +Y LRD Sbjct: 367 YSGHGVMLANYCGKLYAELALGKSTELDLLKQLKIPAFPGGTRFRSALLFLALSWYALRD 426 Query: 424 K 424 + Sbjct: 427 R 427 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 552 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 428 Length adjustment: 32 Effective length of query: 395 Effective length of database: 396 Effective search space: 156420 Effective search space used: 156420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory