GapMind for catabolism of small carbon sources

 

Aligments for a candidate for H281DRAFT_01113 in Sinorhizobium meliloti 1021

Align deoxynucleoside transporter, ATPase component (characterized)
to candidate SM_b20317 SM_b20317 sugar ABC transporter ATP-binding protein

Query= reanno::Burk376:H281DRAFT_01113
         (515 letters)



>lcl|FitnessBrowser__Smeli:SM_b20317 SM_b20317 sugar ABC transporter
           ATP-binding protein
          Length = 516

 Score =  580 bits (1494), Expect = e-170
 Identities = 299/502 (59%), Positives = 381/502 (75%), Gaps = 1/502 (0%)

Query: 12  SQPFLEVVGVHKRFTGVHALRGVSLSFQRGQIYHLLGENGCGKSTLIKIISGAQPPDEGQ 71
           + PFLEV  + KRF GV AL+GVS + +RG+ YHL+GENGCGKSTLIKIISGAQP D G+
Sbjct: 10  TMPFLEVRDLEKRFGGVRALKGVSFTIERGRTYHLMGENGCGKSTLIKIISGAQPADGGE 69

Query: 72  LVIEGVPHARLSALEALAAGIETVYQDLSLLPNMSVAENVALTSELATHEGRLARTFDRR 131
           L I G     L+ + ALAAGIETVYQDLSLLPN+SV ENVALT +L    G LAR  D +
Sbjct: 70  LTINGKKVEGLTPIGALAAGIETVYQDLSLLPNLSVEENVALTQQLVASNGSLARRLDLK 129

Query: 132 VLAATAARALEAVGLPGNSEFQSTLIEQLPLATRQLVAIARAIASEAKFVIMDEPTTSLT 191
            L  TA RAL+ VGLP    F ST +E+LP+ATRQL+AIARAIAS+A  VIMDEPTT+LT
Sbjct: 130 GLRETAVRALKDVGLPTEPAFLSTPVEELPIATRQLIAIARAIASDAGLVIMDEPTTALT 189

Query: 192 QKEVDNLIAVLANLRAQGVTVLFVSHKLDECYAIGGEVIVLRDGQKMAQGPIAEFTKAQI 251
           ++EVDNLI V+  L A+GV+VLFV+HKLDEC AIGG+ I++RDG K+A+  +A  +K ++
Sbjct: 190 RREVDNLIRVVHGLHAKGVSVLFVTHKLDECKAIGGQAIIMRDGLKVAECDVATQSKTEL 249

Query: 252 SELMTGRHLSNERYRESAHAQDIVLDVRGFTRAGQFSDVSFKLHGGEILGVTGLLDSGRN 311
              MTG++L + RYR   H  + +L V     AG F DVSF +  GEI G+TGLLDSGRN
Sbjct: 250 GFWMTGKNLDDTRYRVDTHGDETLLSVERLGGAG-FDDVSFTVSKGEIFGITGLLDSGRN 308

Query: 312 ELARALAGVAPAQSGDVLLDGQQIALRTPSDAKRHRIGYVPEDRLNEGLFLDKPIRDNVI 371
           ELA +LAGV  A+ G VLL G++  L +P+ A    IGYVPEDRL+EGLFL K IR+N++
Sbjct: 309 ELALSLAGVESARRGSVLLAGRRADLSSPASAIEAGIGYVPEDRLSEGLFLGKSIRENIV 368

Query: 372 TAMISSLRDRFGQIDRTRAQALAEQTVKELQIATPGVDKPVQSLSGGNQQRVLIGRWLAI 431
            A++  LR  FG +D  RA+ALA++TV +LQ+ATP +D PV SLSGGNQQRVLIGRWL I
Sbjct: 369 MAVLDRLRGAFGLLDSRRAKALAQKTVDDLQVATPDIDNPVMSLSGGNQQRVLIGRWLTI 428

Query: 432 DPRVLILHGPTVGVDVGSKDIIYRIMQRLSQRGIGIILISDDLPELLQNCDRILMMKKGH 491
           +P +LILHGPTVGVDVGSKD I+RI+QRL+  G+ +++ISDDLPELLQNCDR+++M+KG 
Sbjct: 429 EPSLLILHGPTVGVDVGSKDTIFRIIQRLAGDGMSVVIISDDLPELLQNCDRVMVMRKGR 488

Query: 492 VSAEYRADELSEADLYHALLSE 513
           V+  + A+ L E  +Y ++++E
Sbjct: 489 VADIFPAEGLEEDAIYKSMMAE 510


Lambda     K      H
   0.319    0.135    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 674
Number of extensions: 26
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 515
Length of database: 516
Length adjustment: 35
Effective length of query: 480
Effective length of database: 481
Effective search space:   230880
Effective search space used:   230880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory