GapMind for catabolism of small carbon sources

 

Aligments for a candidate for H281DRAFT_01113 in Sinorhizobium meliloti 1021

Align deoxynucleoside transporter, ATPase component (characterized)
to candidate SM_b20713 SM_b20713 sugar uptake ABC transporter ATP-binding protein

Query= reanno::Burk376:H281DRAFT_01113
         (515 letters)



>lcl|FitnessBrowser__Smeli:SM_b20713 SM_b20713 sugar uptake ABC
           transporter ATP-binding protein
          Length = 513

 Score =  349 bits (895), Expect = e-100
 Identities = 186/486 (38%), Positives = 301/486 (61%), Gaps = 7/486 (1%)

Query: 8   SAPLSQPFLEVVGVHKRFTGVHALRGVSLSFQRGQIYHLLGENGCGKSTLIKIISGAQPP 67
           + P S+  L   GV K F GV AL  V    +RG ++ L+GENG GKSTL+KI++G   P
Sbjct: 16  AVPKSEYLLTAEGVRKEFPGVVALDDVEFKLKRGTVHALMGENGAGKSTLMKILAGIYYP 75

Query: 68  DEGQLVIEGVPHARLSALEALAAGIETVYQDLSLLPNMSVAENVALTSELATHEGRLART 127
           D+G++ + G      S L+AL  GI  ++Q+L+L+P M+VAEN+ +  E     G +   
Sbjct: 76  DQGEVKLRGAGIRLKSPLDALENGIAMIHQELNLMPFMTVAENIWIRREPKNRFGFVDHG 135

Query: 128 FDRRVLAATAARALEAVGLPGNSEFQSTLIEQLPLATRQLVAIARAIASEAKFVIMDEPT 187
             RR+     A+  E + +  + E +   +  L +A RQ+V IA+A++ E+  +IMDEPT
Sbjct: 136 EMRRM----TAKLFERLKIDLDPEIE---VRHLSVANRQMVEIAKAVSYESDVLIMDEPT 188

Query: 188 TSLTQKEVDNLIAVLANLRAQGVTVLFVSHKLDECYAIGGEVIVLRDGQKMAQGPIAEFT 247
           ++LT++EV +L  ++ +LR+QG+ +++++HK++E + I  E  V RDG+ +      E T
Sbjct: 189 SALTEREVAHLFEIIRDLRSQGIGIVYITHKMNELFEIADEFSVFRDGKYIGTHLSNEVT 248

Query: 248 KAQISELMTGRHLSNERYRESAHAQDIVLDVRGFTRAGQFSDVSFKLHGGEILGVTGLLD 307
           +  I  +M GR ++    +E     D+VL V+  T  G F DVSF +  GEILGV GL+ 
Sbjct: 249 RDDIIRMMVGREITQMFPKEEVPIGDVVLSVKNLTLNGVFRDVSFDVRAGEILGVAGLVG 308

Query: 308 SGRNELARALAGVAPAQSGDVLLDGQQIALRTPSDAKRHRIGYVPEDRLNEGLFLDKPIR 367
           SGR+ +A  L GV PA SG + +DG+++ + + + A RHR+ ++ EDR + G  L   I 
Sbjct: 309 SGRSNVAETLFGVTPASSGTIAIDGKEVVIDSANKAIRHRMAFLTEDRKDTGCLLILDIL 368

Query: 368 DNVITAMISSLRDRFGQIDRTRAQALAEQTVKELQIATPGVDKPVQSLSGGNQQRVLIGR 427
           +N+  A++     + G +      A  E+  ++L++ TP + + V++LSGGNQQ+VLIGR
Sbjct: 369 ENMQIAVLQDKFVKRGFVSEREVTAACEEMSRKLRVKTPNLQERVENLSGGNQQKVLIGR 428

Query: 428 WLAIDPRVLILHGPTVGVDVGSKDIIYRIMQRLSQRGIGIILISDDLPELLQNCDRILMM 487
           WL  +PR+LIL  PT G+DVG+K  I+R++  L++ G+ +I+IS ++PE+L   DRI++M
Sbjct: 429 WLLTNPRILILDEPTRGIDVGAKAEIHRLVTELARNGVAVIMISSEMPEVLGMSDRIMVM 488

Query: 488 KKGHVS 493
            +G V+
Sbjct: 489 HEGRVT 494



 Score = 77.0 bits (188), Expect = 1e-18
 Identities = 58/224 (25%), Positives = 113/224 (50%), Gaps = 8/224 (3%)

Query: 289 DVSFKLHGGEILGVTGLLDSGRNELARALAGVAPAQSGDVLLDGQQIALRTPSDAKRHRI 348
           DV FKL  G +  + G   +G++ L + LAG+     G+V L G  I L++P DA  + I
Sbjct: 41  DVEFKLKRGTVHALMGENGAGKSTLMKILAGIYYPDQGEVKLRGAGIRLKSPLDALENGI 100

Query: 349 GYVPEDRLNEGLFLDKPIRDNVITAMISSLRDRFGQIDRTRAQALAEQTVKELQI-ATPG 407
             + ++ LN   F+   + +N+        ++RFG +D    + +  +  + L+I   P 
Sbjct: 101 AMIHQE-LNLMPFMT--VAENIWIRR--EPKNRFGFVDHGEMRRMTAKLFERLKIDLDPE 155

Query: 408 VDKPVQSLSGGNQQRVLIGRWLAIDPRVLILHGPTVGVDVGSKDIIYRIMQRLSQRGIGI 467
           ++  V+ LS  N+Q V I + ++ +  VLI+  PT  +       ++ I++ L  +GIGI
Sbjct: 156 IE--VRHLSVANRQMVEIAKAVSYESDVLIMDEPTSALTEREVAHLFEIIRDLRSQGIGI 213

Query: 468 ILISDDLPELLQNCDRILMMKKGHVSAEYRADELSEADLYHALL 511
           + I+  + EL +  D   + + G     + ++E++  D+   ++
Sbjct: 214 VYITHKMNELFEIADEFSVFRDGKYIGTHLSNEVTRDDIIRMMV 257



 Score = 61.6 bits (148), Expect = 6e-14
 Identities = 60/247 (24%), Positives = 108/247 (43%), Gaps = 13/247 (5%)

Query: 14  PFLEVVGVHKRFTGVHALRGVSLSFQRGQIYHLLGENGCGKSTLIKIISGAQPPDEGQLV 73
           P  +VV   K  T     R VS   + G+I  + G  G G+S + + + G  P   G + 
Sbjct: 271 PIGDVVLSVKNLTLNGVFRDVSFDVRAGEILGVAGLVGSGRSNVAETLFGVTPASSGTIA 330

Query: 74  IEGVPHARLSALEALA---AGIETVYQDLSLLPNMSVAEN--VALTSELATHEGRLARTF 128
           I+G      SA +A+    A +    +D   L  + + EN  +A+  +     G ++   
Sbjct: 331 IDGKEVVIDSANKAIRHRMAFLTEDRKDTGCLLILDILENMQIAVLQDKFVKRGFVS--- 387

Query: 129 DRRVLAATAARALEA-VGLPGNSEFQSTLIEQLPLATRQLVAIARAIASEAKFVIMDEPT 187
           +R V AA    + +  V  P   E     +E L    +Q V I R + +  + +I+DEPT
Sbjct: 388 EREVTAACEEMSRKLRVKTPNLQE----RVENLSGGNQQKVLIGRWLLTNPRILILDEPT 443

Query: 188 TSLTQKEVDNLIAVLANLRAQGVTVLFVSHKLDECYAIGGEVIVLRDGQKMAQGPIAEFT 247
             +       +  ++  L   GV V+ +S ++ E   +   ++V+ +G+       AE T
Sbjct: 444 RGIDVGAKAEIHRLVTELARNGVAVIMISSEMPEVLGMSDRIMVMHEGRVTGILDRAEAT 503

Query: 248 KAQISEL 254
           + ++ EL
Sbjct: 504 QIKVMEL 510


Lambda     K      H
   0.319    0.135    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 581
Number of extensions: 32
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 3
Length of query: 515
Length of database: 513
Length adjustment: 35
Effective length of query: 480
Effective length of database: 478
Effective search space:   229440
Effective search space used:   229440
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory