Align deoxynucleoside transporter, ATPase component (characterized)
to candidate SM_b21344 SM_b21344 sugar uptake ABC transporter ATP-binding protein
Query= reanno::Burk376:H281DRAFT_01113 (515 letters) >FitnessBrowser__Smeli:SM_b21344 Length = 497 Score = 328 bits (841), Expect = 3e-94 Identities = 193/499 (38%), Positives = 286/499 (57%), Gaps = 13/499 (2%) Query: 16 LEVVGVHKRFTGVHALRGVSLSFQRGQIYHLLGENGCGKSTLIKIISGAQPPDEGQLVIE 75 L + G+ K F G+ ALR SL ++ L+G+NG GKSTLIKI++GA DEG +V Sbjct: 3 LSMQGICKSFNGIPALRAASLEVGEAEVMALVGQNGAGKSTLIKILTGAYRRDEGAVVFA 62 Query: 76 GVPHARLSALEALAAGIETVYQDLSLLPNMSVAENVALTSELATHEGRLARTFDRRVLAA 135 G + E+ A GI T+YQ+++L P SVAEN+ L+ E R DRR + Sbjct: 63 GEGVSFSMPAESQARGIATIYQEINLAPQRSVAENIYLS-----REPRRFGLIDRRAMRD 117 Query: 136 TAARALEAVGLPGNSEFQSTLIEQLPLATRQLVAIARAIASEAKFVIMDEPTTSLTQKEV 195 AA L A L + + + ATRQ+VAIARA+ +A+ VIMDEPT+SL ++EV Sbjct: 118 GAAAVLRAFNLEIDVDQP---VAGFSAATRQMVAIARAVTQKARLVIMDEPTSSLDEREV 174 Query: 196 DNLIAVLANLRAQGVTVLFVSHKLDECYAIGGEVIVLRDGQKMAQGPIAEFTKAQISELM 255 L + L+ GV+V+F+ H+L+E Y I V ++RDG+ +A +A+ K + M Sbjct: 175 GILFDTIRTLKRGGVSVVFIGHRLEELYRICDRVTIMRDGKTVATAAMADMPKLALVRHM 234 Query: 256 TGRHLSN----ERYRESAHAQDIVLDVRGFTRAGQFSDVSFKLHGGEILGVTGLLDSGRN 311 G+ L+ + + + + L VR + DVS + GEI G+ GLL SGR Sbjct: 235 LGKELAAFEAIAKDADEGAQRPVRLSVRNAGAGVRVRDVSLTVREGEISGLAGLLGSGRT 294 Query: 312 ELARALAGVAPAQSGDVLLDGQQIALRTPSDAKRHRIGYVPEDRLNEGLFLDKPIRDNVI 371 E A + G Q G++ +G+ A R P+DA IG V EDR +G+ D IR+N+ Sbjct: 295 ETANLIFGADRLQRGEIRYNGEARAYRQPADAIADGIGLVAEDRKVDGIIPDMSIRENMT 354 Query: 372 TAMISSLRDRFGQIDRTRAQALAEQTVKELQIATPGVDKPVQSLSGGNQQRVLIGRWLAI 431 A++ L R G +DR R + E+ + L I D+P++ LSGGNQQ+VL+GRWL Sbjct: 355 LALLPKLA-RAGIVDRARQDEIVERYITALAIKCTSPDQPIKELSGGNQQKVLLGRWLCT 413 Query: 432 DPRVLILHGPTVGVDVGSKDIIYRIMQRLSQRGIGIILISDDLPELLQNCDRILMMKKGH 491 DP++LI+ PT G+D+G+K I R+++RL+ G+G+++IS +L ELL DR+ ++ G Sbjct: 414 DPKLLIVDEPTRGIDIGAKSEILRLLRRLADEGLGVLMISSELEELLAAADRVTVLSDGT 473 Query: 492 VSAEYRADELSEADLYHAL 510 A ELSEA L+ A+ Sbjct: 474 SVAVLPRKELSEAALFAAM 492 Lambda K H 0.319 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 582 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 497 Length adjustment: 34 Effective length of query: 481 Effective length of database: 463 Effective search space: 222703 Effective search space used: 222703 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory