Align deoxynucleoside transporter, permease component 1 (characterized)
to candidate SM_b20315 SM_b20315 sugar ABC transporter permease
Query= reanno::Burk376:H281DRAFT_01115 (357 letters) >FitnessBrowser__Smeli:SM_b20315 Length = 328 Score = 358 bits (920), Expect = e-104 Identities = 176/311 (56%), Positives = 233/311 (74%) Query: 10 LFADRQLNFLLIVNVLVVLVATWLSRGQFVDIDNLQSMGGQLPELGLLALGIMLSMVSGN 69 +FADRQ NFL+ NVLVV +A + F+ + N QSM Q+PEL LLALG+ML+M++G Sbjct: 4 VFADRQFNFLVATNVLVVALAVVFAGETFLSLYNFQSMSAQVPELALLALGVMLAMIAGG 63 Query: 70 GGIDLSGVGLANLSGMVAAMLVPRLVNGDDSPVLYTSLFCAIVLMMGLLGGLLNGVVIAR 129 GGIDLSG+ LANL+G+ + +LV V+ D++P+ ++ LF A+ L++GL GGLLNG +IA Sbjct: 64 GGIDLSGIALANLAGVGSYLLVRDWVSADEAPLAFSWLFAAMALLIGLAGGLLNGALIAF 123 Query: 130 LRLTPILCTLGTQLLFTGFAVVISNGASVHVDYVEPLSDIGNGTVLQVPIAFCIFLAAVI 189 LTPI+ TLGTQL FTG AV +NG+++ + Y+EPL + GN VL VP+ F +F+ Sbjct: 124 AGLTPIIATLGTQLFFTGLAVAFTNGSAITLGYIEPLDNFGNTPVLGVPMCFTLFVVIAA 183 Query: 190 VLGWLLKRSPFGLRLYLMGTNPKAAFYAGIPRARMLITTYAMCGVLASLAGLISATHTSS 249 ++G +L+ +PFG +LYLMG+N KAA YAGIP+ RML+ TY +CGVLAS+AG+I A TSS Sbjct: 184 LIGVVLRFTPFGFKLYLMGSNAKAARYAGIPQRRMLLLTYTVCGVLASIAGIIIAARTSS 243 Query: 250 AKWDYGNSYLLIAILIAVMGGVNPAGGHGRIICVFFAATVLQFLSSLFNLLGVSQFFGDC 309 KWDYG+SY+LIAILI VM GV P GG+GR +CV +AT LQ LSSLFN L +S FF DC Sbjct: 244 VKWDYGSSYVLIAILIVVMAGVRPDGGYGRTVCVVLSATALQMLSSLFNFLDISNFFRDC 303 Query: 310 AWGFLLLLSLA 320 AWG LL++ LA Sbjct: 304 AWGLLLIVFLA 314 Lambda K H 0.327 0.143 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 328 Length adjustment: 29 Effective length of query: 328 Effective length of database: 299 Effective search space: 98072 Effective search space used: 98072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory