GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoD in Sinorhizobium meliloti 1021

Align Purine nucleoside phosphorylase 1; PNP 1; Inosine phosphorylase; Inosine-guanosine phosphorylase; Purine nucleoside phosphorylase I; PNP I; Pu-NPase I; EC 2.4.2.1 (characterized)
to candidate SMc04123 SMc04123 purine nucleoside phosphorylase

Query= SwissProt::P77834
         (274 letters)



>lcl|FitnessBrowser__Smeli:SMc04123 SMc04123 purine nucleoside
           phosphorylase
          Length = 265

 Score =  217 bits (553), Expect = 2e-61
 Identities = 111/241 (46%), Positives = 156/241 (64%), Gaps = 4/241 (1%)

Query: 9   AAQFLKEKFPT-SPQIGLILGSGLGVLADEIEQAIKIPYSDIPNFPVSTVEGHAGQLVYG 67
           AA FLK +    +P+ G++LGSGLG L D + + ++IPY++IP FPVS+V GHAG+ V G
Sbjct: 4   AADFLKGRLGAHAPRYGIVLGSGLGSLVDAVAEPLRIPYAEIPGFPVSSVSGHAGEFVAG 63

Query: 68  QLEGATVVVMQGRFHYYEGYSFDKVTFPVRVMKALGVEQLIVTNAAGGVNESFEPGDLMI 127
           ++    V V+ GR HYYE      +  P+  +K +GVE LI+TN+AG + E   PG +M 
Sbjct: 64  RIGDTPVAVLSGRAHYYERGDAKAMRVPIETLKRIGVENLILTNSAGSLREDMPPGSVMR 123

Query: 128 ISDHINNMGGNPLIGPNDSALGVRFPDMSEAYSKRLRQLAKDVANDIGLRVREGVYVANT 187
           I+DHI   G NPLIG        RF  M+ AY   L    ++ A  +G+ +  GVY+  +
Sbjct: 124 IADHIAFAGANPLIGLESDE---RFVGMTNAYDAALAIGMEEAAERLGIPLARGVYMWFS 180

Query: 188 GPAYETPAEIRMIRVMGGDAVGMSTVPEVIVARHAGMEVLGISCISNMAAGILDQPLTHD 247
           GP++ETPAEIRM R++G DAVGMSTVPEVI+AR  G++V   S ++N AAG+    L+H+
Sbjct: 181 GPSFETPAEIRMARILGADAVGMSTVPEVILARFFGLKVAAASVVTNFAAGMTGSELSHE 240

Query: 248 E 248
           E
Sbjct: 241 E 241


Lambda     K      H
   0.319    0.137    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 201
Number of extensions: 6
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 274
Length of database: 265
Length adjustment: 25
Effective length of query: 249
Effective length of database: 240
Effective search space:    59760
Effective search space used:    59760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

Align candidate SMc04123 SMc04123 (purine nucleoside phosphorylase)
to HMM TIGR01698 (purine nucleotide phosphorylase (EC 2.4.2.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01698.hmm
# target sequence database:        /tmp/gapView.7574.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01698  [M=245]
Accession:   TIGR01698
Description: PUNP: purine nucleotide phosphorylase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   2.2e-133  429.2   4.3   2.5e-133  429.0   4.3    1.0  1  lcl|FitnessBrowser__Smeli:SMc04123  SMc04123 purine nucleoside phosp


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Smeli:SMc04123  SMc04123 purine nucleoside phosphorylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  429.0   4.3  2.5e-133  2.5e-133       2     245 .]      19     262 ..      18     262 .. 0.99

  Alignments for each domain:
  == domain 1  score: 429.0 bits;  conditional E-value: 2.5e-133
                           TIGR01698   2 laivlGsGlgalvealaetvelpyaeiPGfsapavaGhagrllrvrigdrsvlvlegrthayegkdvravvvpvr 76 
                                         ++ivlGsGlg+lv+a+ae++++pyaeiPGf++++v+Ghag+++++rigd++v+vl+gr+h+ye++d++a++vp++
  lcl|FitnessBrowser__Smeli:SMc04123  19 YGIVLGSGLGSLVDAVAEPLRIPYAEIPGFPVSSVSGHAGEFVAGRIGDTPVAVLSGRAHYYERGDAKAMRVPIE 93 
                                         89************************************************************************* PP

                           TIGR01698  77 aaraiGaelliltnaaGslreelgaGslvlladhinltarsPliGlesderfvdltdaydprlrigleelaervd 151
                                         ++++iG+e+liltn+aGslre++++Gs++++adhi++++++PliGlesderfv++t+ayd++l+ig+ee+aer++
  lcl|FitnessBrowser__Smeli:SMc04123  94 TLKRIGVENLILTNSAGSLREDMPPGSVMRIADHIAFAGANPLIGLESDERFVGMTNAYDAALAIGMEEAAERLG 168
                                         *************************************************************************** PP

                           TIGR01698 152 lplaeGvyaqfsGPsyetPaevrmarilGadlvGmstvletilarflGlevlavslvtnlaaGitgeelshaevk 226
                                         +pla+Gvy++fsGPs+etPae+rmarilGad+vGmstv+e+ilarf+Gl+v+a+s+vtn+aaG+tg+elsh+e+k
  lcl|FitnessBrowser__Smeli:SMc04123 169 IPLARGVYMWFSGPSFETPAEIRMARILGADAVGMSTVPEVILARFFGLKVAAASVVTNFAAGMTGSELSHEETK 243
                                         *************************************************************************** PP

                           TIGR01698 227 avaaaagtrlaalladlia 245
                                         ++a+++gtrlaa+l+++i+
  lcl|FitnessBrowser__Smeli:SMc04123 244 QMAPLGGTRLAAILKEMIS 262
                                         *****************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (245 nodes)
Target sequences:                          1  (265 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.38
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory