Align RnsD, component of The (deoxy)ribonucleoside permease; probably takes up all deoxy- and ribonucleosides (cytidine, uridine, adenosine and toxic analogues, fluorocytidine and fluorouridine tested), but not ribose or nucleobases (characterized)
to candidate SMa2369 SMa2369 ABC transporter permease
Query= TCDB::Q8DU39 (318 letters) >FitnessBrowser__Smeli:SMa2369 Length = 314 Score = 169 bits (429), Expect = 6e-47 Identities = 109/305 (35%), Positives = 160/305 (52%), Gaps = 18/305 (5%) Query: 10 LISSMLVYATPLIFTSIGGVFSERSGVVNVGLEGIMVMGAFAGVVFNIEFAHSFGKATPW 69 L +++L ATPLI ++G + ERSGV+N+G+EGIM GA G + + A W Sbjct: 13 LWAAVLRIATPLILGTLGALLCERSGVLNLGIEGIMTFGAMIG------WLAVYNGADLW 66 Query: 70 IAALVGGLVGLLFSLLHALATINFRADHIVSGTVLNLLAPSLAVFFVKALYNKGQTDNIS 129 LV GL G +F LLHA T+ VSG + L A S + + + L T Sbjct: 67 TGILVAGLSGGIFGLLHAGLTVTLGLSQHVSGLGVTLFASSFSYYVFRLLVPVAGTPPTI 126 Query: 130 QSFGKFDFPILSHIPFLGPIFFQGTSLVAYLAVLFSVFAWFILTKTKFGLRLRSVGEHPQ 189 + F D P LS +PFLGP F T Y+A+L ++ ++L +T GL +R GE+P Sbjct: 127 EPFQPIDVPALSSLPFLGPALFTQTP-PTYVAILLALVLGYVLFRTPLGLAIRMTGENPH 185 Query: 190 AADTLGINVYLMRYLGVMISGLLGGIGGAIYAQSISVNFAGTTILGPGFIALAAMIFGKW 249 AA+ GIN +R+ V++ L GIGGA S +F T + G G+I +A ++F W Sbjct: 186 AAEAQGINPMAIRFGSVIVGSALMGIGGAFLTLSAFNSFFPTMVQGRGWICIALVVFASW 245 Query: 250 NP----IGAMLSSLFFGLSQSLAV-IGGQLPFLSKIPTVYLQIAPYALTILVLAVFFGQA 304 P +GA+L +LF G L + G +P+ ++L I PY L+I LA+ +A Sbjct: 246 RPGRALVGALLFALFDGFQLRLQTRLSGVVPY-----QIFLMI-PYLLSIAALALMARRA 299 Query: 305 VAPKA 309 P+A Sbjct: 300 RVPQA 304 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 314 Length adjustment: 27 Effective length of query: 291 Effective length of database: 287 Effective search space: 83517 Effective search space used: 83517 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory