Align alcohol dehydrogenase (cytochrome c) (EC 1.1.2.8) (characterized)
to candidate SMc00086 SMc00086 diheme cytochrome C-type signal peptide protein
Query= BRENDA::D2SZY5 (472 letters) >FitnessBrowser__Smeli:SMc00086 Length = 304 Score = 163 bits (413), Expect = 6e-45 Identities = 104/311 (33%), Positives = 158/311 (50%), Gaps = 27/311 (8%) Query: 2 MINRLKAALGAVAVGLLAGTSLA------------HAQNADEDLIKKGEYVARLGDCVAC 49 M R + L + + ++AG SLA H + + GE + G CV+C Sbjct: 1 MGRRARYLLSGLVLLVVAGASLAWWLTKPDRWDAAHWEGLGGPDLANGEQIFWAGGCVSC 60 Query: 50 HTSLNGQK-----YAGGLSIKTPIGTIYSTNITPDPTYGIGTYTFKEFDEAVRHGVRKDG 104 H++ + GG ++K+P GT Y NI+PD T GIG +T EF +A+ GV KDG Sbjct: 61 HSAPGAKDDQRLVLTGGRTLKSPFGTFYPPNISPDETVGIGNWTLAEFGDAMTRGVGKDG 120 Query: 105 ATLYPAMPYPSFARMTQDDMKALYAYFMHGVQPIAQKNHPTDISWPMSMRWPLSIWRSVF 164 LYP+ PY S+ RMT D+ L+ FM + + P D+++P ++R L W+ ++ Sbjct: 121 EHLYPSFPYGSYIRMTAKDVNDLWG-FMQTLPKSSNATPPHDLAFPYNVRLALGAWKLLY 179 Query: 165 APAPKDFTPAPGTDAEIARGEYLVTGPGHCGACHTPR-GFGMQEKALDASGGPDFLGGGG 223 + + T D ++ARG+YLV GPGHCG CHTPR G E+ +G P+ G G Sbjct: 180 L-SDEPRTQVNTADTKLARGQYLVEGPGHCGECHTPRDALGGFEEDRWLAGAPNPEGEGR 238 Query: 224 VIDNWIAPSLRNDPVLGLGRWSDEDLFLFLKSGRTDHSAAFGGMADVVGWSTQYYTDADL 283 + D I PS ++ +G WS D+ +L++G T GG V + +D Sbjct: 239 IPD--ITPSSKS-----IGDWSASDIASYLETGFTPDFDTVGGSMVEVQKNMAELPASDR 291 Query: 284 HAMVKYIKSLP 294 A+ Y+K+LP Sbjct: 292 DAIAAYLKALP 302 Lambda K H 0.318 0.135 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 512 Number of extensions: 38 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 304 Length adjustment: 30 Effective length of query: 442 Effective length of database: 274 Effective search space: 121108 Effective search space used: 121108 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory