Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate SM_b20352 SM_b20352 sugar ABC transporter permease
Query= uniprot:D8J112 (347 letters) >FitnessBrowser__Smeli:SM_b20352 Length = 354 Score = 240 bits (612), Expect = 5e-68 Identities = 139/352 (39%), Positives = 212/352 (60%), Gaps = 30/352 (8%) Query: 9 TSASTTMANTASAQGLRARLFNPAARQKLLAFASLLLMILFFSFASPNFMEVDNLVSILQ 68 T+ +TT A A++ + L KL F +L ++ FFS +PNF+ NL+ + + Sbjct: 3 TATTTTNATDATSGSVLLTLM------KLRTFIALFAVVAFFSIFAPNFLSTANLILMSK 56 Query: 69 STAVNGVLAIACTYVIITSGIDLSVGTMMTFCAVMAGVVLTNWGMPLPLGIAA------- 121 A+N LA+ T+VIIT GIDLSVG+++ C ++AG ++ N G+ L G Sbjct: 57 HVALNAFLAMGMTFVIITGGIDLSVGSIVGLCGMVAGGLILN-GIDLQFGYTVYFNVVEV 115 Query: 122 ---AIFFGALSGWISGMVIAKLKVPPFIATLGMMMLLKGLSLVISG--TRPIYFNDTE-- 174 + G + G ++G++I KL V PFIATLG + + +G +L+ SG T P E Sbjct: 116 CLITLAVGIVIGAVNGLLITKLNVAPFIATLGTLYVARGFALLSSGGQTFPNLVGKPELA 175 Query: 175 --GFSAIAQDSLIGDLIPSLPIPNAVLILFLVAIGASIILNKTVFGRYTFALGSNEEALR 232 GF+ + L+G +P ++ +L +VA+ A+ + T GR+ FA+G NE A R Sbjct: 176 TTGFAFLGSGRLLG-------LPVSIWVLIVVALAAAYVARYTPIGRHIFAVGGNERAAR 228 Query: 233 LSGVKVDFWKVAVYTFSGAICGIAGLIIASRLNSAQPALGQGYELDAIAAVVIGGTSLSG 292 +SG++VD K+ VY FSG I GL+I+S L ++ PA G +EL+AIAA V+GGTS+SG Sbjct: 229 MSGIRVDRVKMFVYMFSGFCAAIVGLVISSELMASHPATGNSFELNAIAAAVLGGTSMSG 288 Query: 293 GTGTILGTIIGAFIMSVLVNGLRIMSVAQEWQTVVTGVIIILAVYLDILRRR 344 G GTI GTIIGAF++ +L +GL +M ++ WQ V+ G++II+AV +D +RR Sbjct: 289 GRGTIGGTIIGAFVIGILSDGLVMMGISSFWQMVIKGIVIIVAVVVDQAQRR 340 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 354 Length adjustment: 29 Effective length of query: 318 Effective length of database: 325 Effective search space: 103350 Effective search space used: 103350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory