Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate SM_b21423 SM_b21423 sugar uptake ABC transporter permease
Query= uniprot:D8J112 (347 letters) >FitnessBrowser__Smeli:SM_b21423 Length = 331 Score = 204 bits (518), Expect = 3e-57 Identities = 130/344 (37%), Positives = 194/344 (56%), Gaps = 18/344 (5%) Query: 1 MANNIHSATSASTTMANTASAQGLRARLFNPAARQKLLAFASLLLMILFFSFASPNFMEV 60 M +N+ S T + + +R + A LLAF L+ I+FFS +SP F+ Sbjct: 1 MPDNLQSETLPMADLERNRNRAAIRRAPESAA----LLAF--LVAEIIFFSLSSPYFLTW 54 Query: 61 DNLVSILQSTAVNGVLAIACTYVIITSGIDLSVGTMMTFCAVMAGVVLTNWGMPLPLGIA 120 N V++ + ++ GVLA T ++I DLSVG+ + F A++ + + + G+ LP + Sbjct: 55 GNWVNVFTALSITGVLAAGGTMLLIAGQFDLSVGSGVAFVALVLALTIDSLGV-LPASVL 113 Query: 121 AAIFFGALSGWISGMVIAKLKVPPFIATLGMMMLLKGLSLVISGTRPIYFNDTEGFSAIA 180 A + G G I+G ++ ++ V I TLG + + +GL+ I G R I + + AI Sbjct: 114 AMLV-GVGIGLINGFLVTRIGVNALITTLGTLAIFRGLTQSIGGGRNIPIANFDW--AIW 170 Query: 181 QDSLIGDLIPSLPIPNAVLILFLVAIGASIILNKTVFGRYTFALGSNEEALRLSGVKVDF 240 + P L IP + L+ LVAI I+L ++VFGR +A+G+NE A RL G++ Sbjct: 171 R--------PFLNIPLSALVFLLVAIMVGIVLKRSVFGRSIYAIGANENAARLVGIRTKG 222 Query: 241 WKVAVYTFSGAICGIAGLIIASRLNSAQPALGQGYELDAIAAVVIGGTSLSGGTGTILGT 300 A + SGA G+ GLI AS+L S G G EL + AV++GGTSL GGTGT+LGT Sbjct: 223 VVFAGFLLSGAFIGLGGLISASQLGSTSGTTGLGLELAVVTAVILGGTSLKGGTGTMLGT 282 Query: 301 IIGAFIMSVLVNGLRIMSVAQEWQTVVTGVIIILAVYLDILRRR 344 +IG I+ VL NGL +M+V WQ TG+++ILAV D LR+R Sbjct: 283 VIGLLIVGVLNNGLTLMNVNSSWQQAATGLLLILAVSFDQLRQR 326 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 331 Length adjustment: 28 Effective length of query: 319 Effective length of database: 303 Effective search space: 96657 Effective search space used: 96657 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory