Align ABC-type sugar transport system, periplasmic component protein (characterized, see rationale)
to candidate SMc02774 SMc02774 ABC transporter substrate-binding protein
Query= uniprot:D8J113 (312 letters) >FitnessBrowser__Smeli:SMc02774 Length = 329 Score = 175 bits (444), Expect = 1e-48 Identities = 118/318 (37%), Positives = 175/318 (55%), Gaps = 18/318 (5%) Query: 4 NKLLGAALGLAFAMGASAAQAQEAYIPLISKGFQHQFWQAVKAGADQAGKDYKVKVTFEG 63 N L GAA AM + + AQ+ IP+I K +WQ V AGA AGKD V V G Sbjct: 14 NALAGAAF--VAAMVPATSFAQDVTIPIIVKDTTSFYWQIVLAGARAAGKDLGVNVPELG 71 Query: 64 PETEAMVDKQIDMLSAALAKKPQAIGFAALDSKAAIPLLKKAQAAKIPVVAFDSGVDSDI 123 ++E+ ++ QI +L A+A P A+ A + KA + +A A +PV+ DSG DS Sbjct: 72 AQSESDINGQITILENAVAGAPAAVVIAPTEFKALGKPVDEA-AKSVPVIGIDSGADSKA 130 Query: 124 PVTTATTDNRAAAALAADKMA----ELVGKE-GEVAVVAHDQTSRTGV----DRRDGFLE 174 + TTDN +AAD +A E GKE GE+AV+ TS GV RR+GFL+ Sbjct: 131 FTSFLTTDNVQGGRIAADGLAAAIKEATGKEEGEIAVI----TSLPGVGSLDQRREGFLD 186 Query: 175 RIKSAYPKIKVVSVQYGAGDQLKSTEVTKSILQAYPKIKGIFGTNEGSAIGVVNGVKEMK 234 ++K+ YP +KVV+ +Y G + ++ A P + G+F +N A GV + E K Sbjct: 187 QVKTKYPGLKVVADKYADGQATTGLNIMTDLITANPNLVGVFASNLIMAQGVGQAIAENK 246 Query: 235 R--KIIIIGYDSGKQQKDAIREGIMAGAITQNPVGIGYKTVEAAVKAIKGEKLPKVIDTG 292 KI +IG+DS ++ ++EG++AG + Q+P +GY V+ A+ KGEK+ +DTG Sbjct: 247 LGDKIKVIGFDSDEKTVGFLKEGVLAGLVVQDPYRMGYDGVKTALAVSKGEKVEANVDTG 306 Query: 293 FYWYDKSNIDDAKIAAVL 310 K+N+ + KI A+L Sbjct: 307 ANLVTKANMSEPKIDALL 324 Lambda K H 0.315 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 329 Length adjustment: 28 Effective length of query: 284 Effective length of database: 301 Effective search space: 85484 Effective search space used: 85484 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory