Align ABC transporter for L-Fucose, permease component 2 (characterized)
to candidate SM_b20632 SM_b20632 sugar uptake ABC transporter permease
Query= reanno::Smeli:SM_b21105 (288 letters) >FitnessBrowser__Smeli:SM_b20632 Length = 287 Score = 170 bits (431), Expect = 3e-47 Identities = 109/290 (37%), Positives = 164/290 (56%), Gaps = 12/290 (4%) Query: 2 DTNASHRLRRRLLKVAHLAGLFLAMLVICLPGLWIVLSSLRPTVEIMAKP-PVWIPETLS 60 + A LR R+ V H G+ A + P L+S RP E P P W LS Sbjct: 6 EIRARKALRDRI--VYHGIGIGTAFFFLA-PFAVSFLASFRPNSESGRPPLPPWPISGLS 62 Query: 61 LDAYRAMFS-GAGQGGVPVWDYFRNSLIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIF 119 DAYRA+ S GAG +W + NSLIVS+ + V+ +A+ + GY F+RYRF K+A+F Sbjct: 63 FDAYRALDSFGAG-----IWQHMFNSLIVSIGTVVLTVAVSVLAGYGFSRYRFPFKNALF 117 Query: 120 LGFMLTRAVPGIALSLPLFMLYARTGIIDTHFSLILTYVALNVPFTIWLIDGFFRQVPKD 179 + + T +P ++ PLF++ AR G+ ++ L+L YV L +PF+++++ F VPK+ Sbjct: 118 VLIIATLMIPFQSILTPLFIILARFGLNNSLVGLMLVYVTLQLPFSVFMMRNAFDAVPKE 177 Query: 180 LAEAAQIDGCTPWQAFWQVEFPLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPV 239 + EAA+IDG + +V PL PGIA+ IFAFL +WNE+ A + S ++ TLPV Sbjct: 178 IEEAARIDGARDLKLLVRVLLPLVMPGIATVSIFAFLNAWNEFFAALVLLSSNDNYTLPV 237 Query: 240 GLLDYTAE--FTIDWRGMCALAVVMIVPALTLTFIIQKHLVSGLTFGAVK 287 + A I+W + A VM+VP L + ++Q++ + GL GAVK Sbjct: 238 LMTAVRAGRLGAINWGAVQAGVAVMVVPCLFVFLLLQRYYMRGLMAGAVK 287 Lambda K H 0.328 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 287 Length adjustment: 26 Effective length of query: 262 Effective length of database: 261 Effective search space: 68382 Effective search space used: 68382 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory