Align L-fucose dehydrogenase (EC 1.1.1.122) (characterized)
to candidate SMc02775 SMc02775 L-fucose dehydrogenase (D-threo aldose 1-dehydrogenase) protein
Query= reanno::BFirm:BPHYT_RS34225 (346 letters) >FitnessBrowser__Smeli:SMc02775 Length = 339 Score = 282 bits (721), Expect = 1e-80 Identities = 160/306 (52%), Positives = 193/306 (63%), Gaps = 2/306 (0%) Query: 11 QRRRIGRGPLQVTGLGLGTAPLGGLYRDLSDEEAHATIAAAWDAGVRYFDTAPHYGNTKA 70 Q RRIGR L VT GTA LGGLYR+ + E A AT+ AAW+AG+RYFDTAP YG A Sbjct: 2 QTRRIGRTALAVTEYSFGTAGLGGLYRECTREAAMATLDAAWEAGIRYFDTAPFYGLGLA 61 Query: 71 EHRLGDALRRYPRADYVLSTKVGRRFVPRTTPFDDKEGWQNPLPFEAIYDYTHDGILRSF 130 E R+GD LR PR +VLSTKVGR P + PL F+ YDY +D I+RS Sbjct: 62 ERRVGDFLRDKPRDSFVLSTKVGRLLHPVPENQVPDYSYVKPLNFDVTYDYGYDAIMRSV 121 Query: 131 EDSQQRLGIVDIDILLVHDIGRVTHGD-NHPHYWRQLTEGGGFRALDALRSSGAIKAVGL 189 E S RLG+ IDIL VHDIG THG + Y RQL + G +ALD L+SSG I A GL Sbjct: 122 EMSYARLGLNRIDILYVHDIGGYTHGAAKNAVYLRQLLDSG-LKALDELKSSGVISAYGL 180 Query: 190 GVNEGAAILDAMAEFDIDCALLAGRYTLLEQTTLDDLLPACEKRGVSILLGGAFNSGILA 249 GVNE LD M + DIDC LLAGRYTLL+++ + +LLP C K+ S+++GG FNSGILA Sbjct: 181 GVNEVPVCLDVMRQADIDCILLAGRYTLLDRSAVAELLPLCAKKDTSLVVGGVFNSGILA 240 Query: 250 RGVQGDLKFNYGEAPPEVIERVARLEAVCRTHGVPLAAAALQFPYAHPTVATVLTGARSA 309 G F+Y A EV +VA +E + G+PLAA ALQFP A+P VA+VL G Sbjct: 241 TGPVEGAHFDYMPATGEVRAKVAAMERIAGERGMPLAAPALQFPLANPHVASVLLGTAKP 300 Query: 310 DELREN 315 L N Sbjct: 301 SSLTRN 306 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 339 Length adjustment: 29 Effective length of query: 317 Effective length of database: 310 Effective search space: 98270 Effective search space used: 98270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory