Align L-fuconate dehydratase; FucD; EC 4.2.1.68 (characterized)
to candidate SM_b21107 SM_b21107 mandelate racemase or evolutionary related enzyme of the mandelate racemase muconate lactonizing enzyme family protein
Query= SwissProt::Q8P3K2 (441 letters) >FitnessBrowser__Smeli:SM_b21107 Length = 370 Score = 132 bits (331), Expect = 2e-35 Identities = 107/393 (27%), Positives = 174/393 (44%), Gaps = 67/393 (17%) Query: 37 VVLRTDGAEDLAGYGLVFTIGRGNDVQTAAVAALAEHVVGLSVDKVIADLGAFARRLTND 96 +V TD A+ G G +TIG G ++ + L++H+V + + + + A +++ Sbjct: 34 IVTITD-ADGATGTGYSYTIGTGG---SSVMRLLSDHLVPILLGEDADCIEALWQKMEFA 89 Query: 97 SQLRWLGPEKGVMHMAIGAVINAAWDLAARAANKPLWRFIAELTPEQLVDTIDFRYLSDA 156 + +G + +A+ AV A WDL A+ PLW+ Sbjct: 90 THATTIG---AITALALAAVDTALWDLRAKKQKLPLWKL--------------------- 125 Query: 157 LTRDEALAILRDAQPQRAARTATLIEQGYPAYTTSPGWLGYSDEKLVRLAKEAVADGFRT 216 A ++ P YTT GWL + LV A +A A+GF Sbjct: 126 ---------------------AGGAKESCPLYTTEGGWLHIEKQALVDDALQAKANGFSG 164 Query: 217 IKLKVGA-NVQDDIRRCRLARAAIGPDIAMAVDANQRWDVGPAIDWMRQLAEFDIAWIEE 275 K+K+G + +D R RAA+G + D NQ + V AI +L E D+AWIEE Sbjct: 165 SKVKIGKPSGAEDYDRLSAMRAALGDGFEIMTDCNQGFTVDEAIRRAARLRELDLAWIEE 224 Query: 276 PTSPDDVLGHAAIRQGITPVPVSTGEHTQNRVVFKQLLQAGAVDLIQIDAARVGGVNENL 335 P DD+ GH + + TP P++ GE + F++ +Q GA ++Q+D AR+GG+ L Sbjct: 225 PLPADDLDGHIRLTRS-TPTPIAVGESIYSIRHFREYMQKGACSIVQVDVARIGGITPWL 283 Query: 336 AILLLAAKFGVRVFPHAGGVGLCELVQHLAMADFVAITGKMEDRAIEFVDHLHQHFLDPV 395 + A F + V PH L EL H+++ + + +E++ L + Sbjct: 284 KVAHAAEAFDIPVCPHF----LMEL--HVSL-----VCAVPNGKYVEYIPQLDDLTQMGM 332 Query: 396 RIQHGRYLAPEVPGFS-----AEMHPASIAEFS 423 I+ GR +AP PG + S+AEF+ Sbjct: 333 EIREGRAIAPSNPGIGIAWDWEAVKARSVAEFT 365 Lambda K H 0.321 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 370 Length adjustment: 31 Effective length of query: 410 Effective length of database: 339 Effective search space: 138990 Effective search space used: 138990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory