Align L-fuconate dehydratase; FucD; EC 4.2.1.68 (characterized)
to candidate SMa1351 SMa1351 enolase
Query= SwissProt::Q8P3K2 (441 letters) >FitnessBrowser__Smeli:SMa1351 Length = 402 Score = 94.4 bits (233), Expect = 6e-24 Identities = 71/250 (28%), Positives = 111/250 (44%), Gaps = 49/250 (19%) Query: 106 KGVMHMAIGAVINAAWDLAARAANKPLWRFIAELTPEQLVDTIDFRYLSDALTRDEALAI 165 +G+ AI AV A WD+ ++ P+W+ + ++L Sbjct: 125 RGLSIAAISAVDIALWDILGKSLGVPVWKLLGGRKADRL--------------------- 163 Query: 166 LRDAQPQRAARTATLIEQGYPAYTTSPGWLGYSDEKLV-RLAKEAVADGFRTIKLKVGAN 224 PAY S GW S EK+ +L + GF+ +K++VGA Sbjct: 164 --------------------PAYA-SGGW--ESAEKIGGQLQSYLASGGFKAVKMRVGAM 200 Query: 225 ---VQDDIRRCRLARAAIGPDIAMAVDANQRWDVGPAIDWMRQLAEFDIAWIEEPTSPDD 281 R R AR A+GP + + VDA+ + V A +++ + + D+AW EEP DD Sbjct: 201 DGAPYVSAARVRAARKALGPSVDIMVDAHGTYTVADAKRFIQLVRDCDLAWFEEPVIADD 260 Query: 282 VLGHAAIRQGITPVPVSTGEHTQNRVVFKQLLQAGAVDLIQIDAARVGGVNENLAILLLA 341 G A +R VP++TGE R F+ L + D+ Q D A GG+ E + I +A Sbjct: 261 KAGMAEVR-AAGNVPIATGESEATRFAFRDLAVLRSADIFQPDPAFCGGITEAMRIGAIA 319 Query: 342 AKFGVRVFPH 351 + F +R+ PH Sbjct: 320 SAFNLRLAPH 329 Lambda K H 0.321 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 443 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 402 Length adjustment: 32 Effective length of query: 409 Effective length of database: 370 Effective search space: 151330 Effective search space used: 151330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory