Align Short-chain alcohol dehydrogenase protein (characterized, see rationale)
to candidate SM_b21111 SM_b21111 oxidoreductase, RED superfamily protein
Query= uniprot:D8IS13 (254 letters) >FitnessBrowser__Smeli:SM_b21111 Length = 244 Score = 297 bits (761), Expect = 1e-85 Identities = 152/249 (61%), Positives = 189/249 (75%), Gaps = 7/249 (2%) Query: 5 TGRLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKPHLDELAGIAGVETHLLDVT 64 T LAGK VL+TAAAQGIGRA+ FA+ GA+V ATDI+ + L G AG+ TH LDV Sbjct: 2 TANLAGKVVLVTAAAQGIGRATALAFAKAGAKVHATDINADAVGSLEGEAGISTHRLDVL 61 Query: 65 DDAAIKALVAKIGTIDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTIRAVLPGM 124 D AA++ALVA+IG +DVLFNCAG+V AG++L D+ DF+F+LN K+M TIRAVLPGM Sbjct: 62 DTAAVEALVAEIGAVDVLFNCAGFVHAGSVLTMKDEDLDFAFDLNVKSMIRTIRAVLPGM 121 Query: 125 LAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVAQGIRCNAICPGTI 184 +A+K GSIVN+AS ASS+KGV NRFAYG +KAAV+GLTK+VAAD+V GIRCNAICPGT+ Sbjct: 122 IARKDGSIVNMASVASSIKGVPNRFAYGVTKAAVIGLTKAVAADYVGDGIRCNAICPGTV 181 Query: 185 ESPSLNQRISTQAKETGKSEEEVRAAFVGRQPMGRIGKAEEVAALALYLASDESNFTTGS 244 ESPSL R+ Q E RAAF+ RQPMGR+G EE+A LA+YLA + +T+G Sbjct: 182 ESPSLESRMRAQG-----DYETARAAFISRQPMGRLGTPEEIADLAVYLAG--ATYTSGQ 234 Query: 245 IHMIDGGWS 253 + IDGGW+ Sbjct: 235 AYAIDGGWT 243 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 244 Length adjustment: 24 Effective length of query: 230 Effective length of database: 220 Effective search space: 50600 Effective search space used: 50600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory